DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AgaP_AGAP009730

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_318814.4 Gene:AgaP_AGAP009730 / 1279139 VectorBaseID:AGAP009730 Length:1581 Species:Anopheles gambiae


Alignment Length:310 Identity:106/310 - (34%)
Similarity:162/310 - (52%) Gaps:26/310 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQ-NESQVAVKTIDMKNQSSKDLILTEIRVLKDFN-HKNL 350
            ||..|||..:.:|.|....|:.|.|.| ....||:|....:.: :|..|..|.|:|:|.: |.||
Mosquito    11 DPGNRYKLGELIGSGVCAKVYRATDTQAGNKNVAIKVQKFEGE-TKTAIQEEFRILRDHSKHANL 74

  Fly   351 VNFLDAYLLE-PE---DQLWVVMEYMDGGPLTDVVTETVMKER-----QIACVCRETLYAISFLH 406
            ::|...|..: |.   |::|.|:||.|.||..|||.:..:..|     |:|.:.||...|:.:||
Mosquito    75 IDFYGIYRKKCPAGECDEIWFVLEYCDYGPAVDVVRKLFVNNRRASELQLAYILREVSRALVYLH 139

  Fly   407 AKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEVVTRKK-----Y 465
            ...|:|||::..|:||..||.||:.|:|...:.:.. .||.|.:|:|.||||||||..|     |
Mosquito   140 EHHIVHRDVRGSNILLTKDGEVKLCDYGLARDTKSTLGKRGTCIGSPCWMAPEVVTSSKSDKDVY 204

  Fly   466 GKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEV 530
            ..:.|:|::||.|||:.:|:||:......||::.|..|..|.:......|....||:..||:...
Mosquito   205 DNRSDVWALGITAIELGDGKPPFADMHATRAMFQIVRNPPPTLYRQSNWSQEYNDFIAECLEKNP 269

  Fly   531 DRRATADELLSHPFL-----ND---CSEVKALVPNIKAAKKVLRRNVXLL 572
            |.|....|::.||||     ||   ..|:|.|..::::.:...:..|.::
Mosquito   270 DHRPFIMEVIEHPFLTQVPENDYHLSQELKMLAESVQSTQLPKKEEVAVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 98/273 (36%)
S_TKc 293..545 CDD:214567 95/268 (35%)
AgaP_AGAP009730XP_318814.4 PKc_like 9..284 CDD:304357 98/273 (36%)
S_TKc 16..284 CDD:214567 95/268 (35%)
MYSc 330..1051 CDD:214580
MYSc_Myo21 347..1039 CDD:276848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.