DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AgaP_AGAP003180

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_312877.4 Gene:AgaP_AGAP003180 / 1273851 VectorBaseID:AGAP003180 Length:431 Species:Anopheles gambiae


Alignment Length:301 Identity:80/301 - (26%)
Similarity:143/301 - (47%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 ERYKTTQEVGKGASGIVFIAADLQNESQVAVKT-IDMKNQSS-KDLILTEIRVLKDFNHKNLVNF 353
            :||:....:|:|:.|:|:...|.:..|.||||. ::.::..: :.:.|.|||:||:..|.|||..
Mosquito    82 DRYEKLSRLGEGSYGVVYKCRDRETGSLVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVCL 146

  Fly   354 LDAYLLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQ---IAC-------VCRETLYAISFLHAK 408
            |:.:  ..:.:|.:|.|:.:         .||:.|.:   ..|       :..:|:..:::.|.:
Mosquito   147 LEVF--RRKRRLHLVFEFCE---------HTVLHELERHPEGCPDNLTKQITYQTIQGVAYCHKQ 200

  Fly   409 GIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPE-VVTRKKYGKKVDIW 472
            |.:|||||.:|:||...|.||:.||||...:...|.....|.|.::.||| :|...:||..||:|
Mosquito   201 GCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVW 265

  Fly   473 SIGIMAIEMIEGQPPYLYETPLRALYLIAAN------------------------GRPDIKSWDK 513
            :||.:..|::.|...:...:.:..||||...                        ..|.:::.:.
Mosquito   266 AIGCVFAELVRGDALWPGRSDVDQLYLIRRTLGDLLPRHLAIFNQNEFFKGITLPVPPTLETLEA 330

  Fly   514 LSPN-------LQDFLDRCLQVEVDRRATADELLSHPFLND 547
            ..|:       :.|||.:||..:..:|.:.:.|.:||:..|
Mosquito   331 KMPSRTLANPLMMDFLKKCLDKDPAKRWSCERLATHPYFED 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 79/297 (27%)
S_TKc 293..545 CDD:214567 78/295 (26%)
AgaP_AGAP003180XP_312877.4 STKc_CDKL1_4 82..369 CDD:270837 79/297 (27%)
Pkinase 84..369 CDD:278497 78/295 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.