DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AgaP_AGAP000747

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_003437088.1 Gene:AgaP_AGAP000747 / 1272336 VectorBaseID:AGAP000747 Length:1499 Species:Anopheles gambiae


Alignment Length:341 Identity:105/341 - (30%)
Similarity:169/341 - (49%) Gaps:49/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 AQKTDAEIYVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKD 333
            |.:|.|:   ||:...:.||..:|..    :|||..|.|:.|.||..:.::|||.:..:|.....
Mosquito   619 AAETTAD---ELKYEYDLDDEGQRIL----LGKGTYGAVYAARDLTTQVKIAVKEVYERNTHDVQ 676

  Fly   334 LILTEIRVLKDFNHKNLVNFLDAYLLEPEDQLW-VVMEYMDG-----------GPLTDVVTETVM 386
            .:..||::.....|:|:|.:..:   :.|:|.: :.||.:.|           |||.|       
Mosquito   677 PLHEEIKLHSQLRHRNIVQYWGS---KSENQYFKIFMEQVPGGSLSALLSSKWGPLKD------- 731

  Fly   387 KERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLG-MDGSVKVTDFGFCANIEG-DEKRQTMV 449
            .|..||...|:.|..:.:||.:.|:|||||..|||:. ..|.||::|||....:.| :...:|..
Mosquito   732 SETTIAFYSRQILEGLKYLHDQKIVHRDIKGGNVLVNTYSGVVKISDFGTSKRLAGINPATETFT 796

  Fly   450 GTPYWMAPEVVTR--KKYGKKVDIWSIGIMAIEMIEGQPPYL-YETPLRALYLIA-ANGRPDIKS 510
            ||..:|||||:.:  :.||...||||.|...:||..|:||:: ...|..|::.:. ....|.|. 
Mosquito   797 GTLQYMAPEVIDQGVRGYGPAADIWSFGCTVVEMATGKPPFVELGCPQAAMFKVGFYKTHPTIP- 860

  Fly   511 WDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCSEVKALVPNIKAAKKV----------L 565
             ::||...::|:.||.:|.||:||||.|||..|||  |.:.|.:.|:..::..:          .
Mosquito   861 -EELSSMAKNFILRCFEVNVDKRATATELLEDPFL--CEKHKKMRPSFSSSSTISGLPHPGASEF 922

  Fly   566 RRNVXLLCNHRTARLL 581
            .|:|.:..:...::.|
Mosquito   923 SRSVSMPADRHNSKTL 938

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 91/274 (33%)
S_TKc 293..545 CDD:214567 89/269 (33%)
AgaP_AGAP000747XP_003437088.1 DUF4071 119..492 CDD:290020
STKc_ASK 627..894 CDD:270794 93/282 (33%)
S_TKc 641..894 CDD:214567 89/268 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.