DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and AgaP_AGAP011295

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_309350.4 Gene:AgaP_AGAP011295 / 1270635 VectorBaseID:AGAP011295 Length:738 Species:Anopheles gambiae


Alignment Length:226 Identity:64/226 - (28%)
Similarity:101/226 - (44%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 YMDGGPLTD-VVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDG-------- 426
            |.:||.|.| :..:..:.|..|.....:...|:..|:...::|||:|..|:||..:.        
Mosquito     1 YCNGGDLADYLAVKGTLSEDTIRLFLGQLANAMKALYQADVVHRDLKPQNILLSHNCGKGLPIPS 65

  Fly   427 --SVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYL 489
              ::|:.||||...::......|:.|:|.:|||||:...:|..|.|:||:|.:..:.:.|:.|:.
Mosquito    66 KITLKIADFGFARFLQDGNMAATLCGSPMYMAPEVIMSLQYDAKADLWSLGTIVFQCLTGKAPFQ 130

  Fly   490 YETP--LRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLN------ 546
            ..||  |:..|...||..|.|.|  ..|..|.|.|...|:.....|...|...:||||.      
Mosquito   131 AHTPQELKMFYERNANLAPKIPS--GTSKELTDLLMGLLRRNAKERMNFDTFFNHPFLQRAETPQ 193

  Fly   547 -----DCSEVKALVPNIKAAKKVLRRNVXLL 572
                 :.:||...:|        ||.:|.:|
Mosquito   194 GKNGFNIAEVTVAIP--------LRESVSIL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 55/186 (30%)
S_TKc 293..545 CDD:214567 55/186 (30%)
AgaP_AGAP011295XP_309350.4 S_TKc <1..186 CDD:214567 55/186 (30%)
PKc_like <1..185 CDD:304357 54/185 (29%)
DUF3543 532..726 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.