DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and nuak1

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_002931675.2 Gene:nuak1 / 100491029 XenbaseID:XB-GENE-980289 Length:660 Species:Xenopus tropicalis


Alignment Length:344 Identity:84/344 - (24%)
Similarity:163/344 - (47%) Gaps:61/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 GAQDAGAD-----------------DNPDETILRRSKEKRAQKTDAEIYVELRAICNSDDPRERY 293
            |..:.|||                 |..|:|....:|:...::..           :..:.:.||
 Frog     5 GKPEPGADAKSPVVGLAEQMHLSPCDEEDDTAGALAKQHGVKRHH-----------HKHNLKHRY 58

  Fly   294 KTTQEVGKGASGIVFIAADLQNESQVAVKTIDM-KNQSSKDL--ILTEIRVLKDFNHKNLVNFLD 355
            :..:.:|||..|.|..|.:..:...||:|:|.. |.:..:|:  |..||.::...||.:::...:
 Frog    59 ELLETLGKGTYGKVKRAIERFSGRVVAIKSIRKDKIRDEQDMVHIRREIEIMSSLNHPHIIRIYE 123

  Fly   356 AYLLEPEDQLWVVMEYMDGGPLTDVVTE-TVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDN 419
            .:  |.:|::.::|||...|.|.|.::| ..:.||:.....|:.:.|:.:.|..|::|||:|.:|
 Frog   124 VF--ENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLEN 186

  Fly   420 VLLGMDGSVKVTDFGFCANIEGDEKRQTMVGTPYWMAPEVVTRKKY-GKKVDIWSIGIMAIEMIE 483
            :||..:|::|:.|||.....:.|:..||..|:|.:.:||:|..:.| |.:||.|::|::...::.
 Frog   187 ILLDENGNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVY 251

  Fly   484 GQPP---YLYETPLRALYLIAANGRPDIKSWDKLSP----NLQDFLDRCLQVEVDRRATADELLS 541
            |..|   :.::..:|           .|.|.:...|    :.:..:...|.|..:||||.:::.:
 Frog   252 GTMPFDGFDHKNLIR-----------QISSGEYREPTQPSDARGLIRWMLMVNPERRATIEDIAN 305

  Fly   542 HPFLN--------DCSEVK 552
            |.::|        ||..::
 Frog   306 HWWVNWSYKSSVCDCDVLR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 73/268 (27%)
S_TKc 293..545 CDD:214567 72/263 (27%)
nuak1XP_002931675.2 STKc_NUAK 56..309 CDD:270975 73/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.