DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and nrk

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_031747384.1 Gene:nrk / 100486469 XenbaseID:XB-GENE-952099 Length:1237 Species:Xenopus tropicalis


Alignment Length:287 Identity:109/287 - (37%)
Similarity:160/287 - (55%) Gaps:23/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 YVELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRV 341
            |::|.::   .:|...::..:.||.|..|.|:....::.....|:|.:::..:..:::.| ||.:
 Frog    12 YIDLASL---REPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTEEEEEEIKL-EINM 72

  Fly   342 LKDF-NHKNLVNFLDAY----LLEPEDQLWVVMEYMDGGPLTDVVTET---VMKERQIACVCRET 398
            ||.: :|:|:..:..|:    |...:||||:||||...|.:||:|.:|   ..||..||.:|||.
 Frog    73 LKKYSHHRNIATYYGAFVRKGLAGQDDQLWLVMEYCGAGSVTDLVKKTKGNCFKEDWIAYICREV 137

  Fly   399 LYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEVVT- 461
            |..::.|||..:||||||..||||..:..||:.|||..|.::.. .:|.|.:||||||||||:. 
 Frog   138 LRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIAC 202

  Fly   462 ----RKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKS--WDKLSPNLQD 520
                ...|..:.|:||:||.||||.||.||.....|:|||:||..|..|.:||  |.|...|   
 Frog   203 DENPDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSRKWSKKCIN--- 264

  Fly   521 FLDRCLQVEVDRRATADELLSHPFLND 547
            |:|.||......|.:.|.||.|.|:.|
 Frog   265 FVDSCLVKNYSHRPSTDTLLKHAFVRD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 105/272 (39%)
S_TKc 293..545 CDD:214567 104/267 (39%)
nrkXP_031747384.1 STKc_MAP4K4_6_N 8..289 CDD:270806 107/283 (38%)
CNH 919..1215 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.