DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and map4k3

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_012818238.1 Gene:map4k3 / 100170570 XenbaseID:XB-GENE-951441 Length:924 Species:Xenopus tropicalis


Alignment Length:265 Identity:106/265 - (40%)
Similarity:155/265 - (58%) Gaps:9/265 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVN 352
            :|:|.::..|.:|.|..|.|:.|.::......|:|.|.::......::..||.::||..|.|:|.
 Frog    11 NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHTNIVA 75

  Fly   353 FLDAYLLEPEDQLWVVMEYMDGGPLTDVVTET-VMKERQIACVCRETLYAISFLHAKGIIHRDIK 416
            :..:||  ..|:||:.||:..||.|.|:...| .:.|:|||.|.||||..:.:||:||.:|||||
 Frog    76 YFGSYL--RRDKLWICMEFCGGGSLQDIYHVTGPLSEQQIAYVSRETLQGLYYLHSKGKMHRDIK 138

  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEV--VTRK-KYGKKVDIWSIGIM 477
            ..|:||..:|.||:.|||..|.|... .||::.:||||||||||  |.|| .|.:..|||::||.
 Frog   139 GANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWAVGIT 203

  Fly   478 AIEMIEGQPPYLYETPLRALYLIAANG--RPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELL 540
            :||:.|.|||.....|:|||:|:..:.  .|.:|...|.|.:...|:...|.....:|.||::||
 Frog   204 SIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFIKMALTKNPKKRPTAEKLL 268

  Fly   541 SHPFL 545
            .||||
 Frog   269 QHPFL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 104/263 (40%)
S_TKc 293..545 CDD:214567 102/258 (40%)
map4k3XP_012818238.1 STKc_MAP4K3_like 15..272 CDD:270788 101/258 (39%)
S_TKc 16..273 CDD:214567 102/258 (40%)
CNH 591..904 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.