DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak3 and nek1

DIOPT Version :9

Sequence 1:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_012827049.2 Gene:nek1 / 100036653 XenbaseID:XB-GENE-983162 Length:1320 Species:Xenopus tropicalis


Alignment Length:307 Identity:78/307 - (25%)
Similarity:137/307 - (44%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 RYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL--ILTEIRVLKDFNHKNLVNFL 354
            :|....::|:|:.|...:.....:..|..:|.|.:...|:|:.  ...|:.||.:..|.|:|.:.
 Frog     3 KYVRVSKIGEGSFGKAILVKSKDDGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQ 67

  Fly   355 DAYLLEPEDQLWVVMEYMDGGPLTDVVTE---TVMKERQIACVCRETLYAISFLHAKGIIHRDIK 416
            :::  |....|::||:|.:||.|...:..   .:..|.||.....:...|:..:|.:.|:|||||
 Frog    68 ESF--EESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIK 130

  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIE 480
            |.|:.|...|::::.|||....:... |..:|.:||||:::||:...:.|..|.|||::|.:..|
 Frog   131 SQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYE 195

  Fly   481 M-------------------IEGQ-PP----YLYE--TPLRALYLIAANGRPDIKSWDKLSPNLQ 519
            |                   |.|. ||    |.|:  ..|..|:......||.:.|..:     :
 Frog   196 MCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILE-----K 255

  Fly   520 DFLDRCLQVEVDRRATADE-----LLSHPFLNDCSEVKALVPNIKAA 561
            .|:.|.::..:..:..|:|     .::||           .|.|:||
 Frog   256 PFIYRRIEKFLSPQHIAEEFGLGAFVNHP-----------KPGIQAA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 74/289 (26%)
S_TKc 293..545 CDD:214567 74/288 (26%)
nek1XP_012827049.2 STKc_Nek1 3..258 CDD:270858 68/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.