DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and TPR1

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_194777.3 Gene:TPR1 / 829171 AraportID:AT4G30480 Length:277 Species:Arabidopsis thaliana


Alignment Length:275 Identity:93/275 - (33%)
Similarity:152/275 - (55%) Gaps:19/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NANSDDEF---HDAIGEEITEKEATSTRQSEKDVDEIVEKQNQLAL-DDEAEQGAAGGDSIATPT 64
            ::.|:||.   ::......:..:.|.|:|.:.|..:..|..::..: |:|.|:.....|::    
plant     6 SSESEDEILIKNEPKPASSSSPQPTETKQVDGDDSDGFETASEREISDEEGEEDGTKNDAV---- 66

  Fly    65 TVDSELTIEELREREKDLSPEQLT-----ANKEK----ADKLKVEGNELFKNDDAEGAAKTYTEA 120
            |...|....|.:|.:.:|..|...     :||||    |::.|.|||:||.|...|.|...|..|
plant    67 TSQEEPQHSEKKEEQIELMSEGEAIVDDGSNKEKALAEANEAKAEGNKLFVNGLYEEALSKYAFA 131

  Fly   121 LDICPS--ASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKP 183
            |::...  .|.:.|::.|.||....:||...:..|.:||||:||.|.|.:.|:|||:.:|:.:..
plant   132 LELVQELPESIELRSICYLNRGVCFLKLGKCEETIKECTKALELNPTYNKALVRRAEAHEKLEHF 196

  Fly   184 DEALEDYKKVTEIDPGQQEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPFGLSTQNFQ 248
            ::|:.|.||:.|:||...:||:...||.|:..|:.||:|.|.::.||::||.||..||:|..||:
plant   197 EDAVTDLKKILELDPSNDQARKGIRRLEPLAAEKREKMKEEAITKLKEMGNSILGRFGMSVDNFK 261

  Fly   249 MQQDPNTGSYSINFK 263
            ..:||||||||::|:
plant   262 AVKDPNTGSYSLSFQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 28/76 (37%)
TPR repeat 94..122 CDD:276809 12/27 (44%)
TPR_11 132..198 CDD:290150 25/65 (38%)
TPR repeat 132..162 CDD:276809 11/29 (38%)
TPR_1 133..166 CDD:278916 13/32 (41%)
TPR 167..198 CDD:197478 10/30 (33%)
TPR repeat 167..195 CDD:276809 9/27 (33%)
TPR1NP_194777.3 TPR_11 104..177 CDD:290150 27/72 (38%)
TPR repeat 105..133 CDD:276809 12/27 (44%)
TPR repeat 138..175 CDD:276809 12/36 (33%)
TPR_11 145..211 CDD:290150 25/65 (38%)
TPR 148..179 CDD:197478 13/30 (43%)
TPR repeat 180..208 CDD:276809 9/27 (33%)
TPR_1 181..213 CDD:278916 12/31 (39%)
TPR repeat 214..244 CDD:276809 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3549
eggNOG 1 0.900 - - E1_KOG4234
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2485
Inparanoid 1 1.050 144 1.000 Inparanoid score I1759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418232at2759
OrthoFinder 1 1.000 - - FOG0006488
OrthoInspector 1 1.000 - - oto3759
orthoMCL 1 0.900 - - OOG6_103243
Panther 1 1.100 - - LDO PTHR46014
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5464
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.920

Return to query results.
Submit another query.