DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc1 and TPR8

DIOPT Version :10

Sequence 1:NP_650543.1 Gene:Ttc1 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001031594.1 Gene:TPR8 / 826386 AraportID:AT4G08320 Length:427 Species:Arabidopsis thaliana


Alignment Length:208 Identity:56/208 - (26%)
Similarity:87/208 - (41%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TPTTVDSELTIEE--------LREREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYT 118
            ||...|....:|:        :.|.||  |..|.......|:.||.:||:..:::....|.:.|:
plant   137 TPDGDDDPAQLEKATRIFHDCVNEMEK--SGCQTFDVNSLAETLKCQGNKAMQSNLYLEAVELYS 199

  Fly   119 EALDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKP 183
            .|:     |.:.:.||.|.|||||..::.....||.||.|:||:.|.|.:...|....|..:.|.
plant   200 FAI-----ALTDKNAVFYCNRAAAYTQINMCSEAIKDCLKSIEIDPNYSKAYSRLGLAYYAQGKY 259

  Fly   184 DEALE-DYKKVTEIDPGQQEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPFGLSTQNF 247
            .||:| .:||...:||..:..:| .||:      ..:|::.|.....:...|         |..|
plant   260 AEAIEKGFKKALLLDPHNESVKE-NIRV------AEQKIREEQQRQRRSQQN---------TSTF 308

  Fly   248 QMQQDPNTGSYSI 260
            ..|:....|...|
plant   309 YTQEPEMGGGQGI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc1NP_650543.1 3a0801s09 16..>232 CDD:273380 50/178 (28%)
TPR repeat 94..122 CDD:276809 8/27 (30%)
TPR repeat 132..162 CDD:276809 14/29 (48%)
TPR repeat 167..195 CDD:276809 8/28 (29%)
TPR8NP_001031594.1 SGTA_dimer 12..73 CDD:465168
TPR 172..>284 CDD:440225 37/117 (32%)
TPR repeat 175..203 CDD:276809 8/32 (25%)
TPR repeat 208..238 CDD:276809 14/29 (48%)
TPR repeat 243..271 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.