DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and TOC64-III

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_188424.2 Gene:TOC64-III / 819660 AraportID:AT3G17970 Length:589 Species:Arabidopsis thaliana


Alignment Length:159 Identity:48/159 - (30%)
Similarity:73/159 - (45%) Gaps:6/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GAAGGDSIATPTTVDSELTIEELREREKD-LSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKT 116
            |..|||.....|......:::|......| .|.::....:|.|:..|.:||:.||....:.|...
plant   432 GRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEKGNQAFKEKLWQKAIGL 496

  Fly   117 YTEALDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQED 181
            |:||:.:     |...|..|.|||||.::|.....|.:||||||.|..:.|:..|||....|...
plant   497 YSEAIKL-----SDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKKNVKAYLRRGTAREMLG 556

  Fly   182 KPDEALEDYKKVTEIDPGQQEAREAQIRL 210
            ....|:||::....::|..:.|..:..||
plant   557 DCKGAIEDFRYALVLEPNNKRASLSAERL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 27/70 (39%)
TPR repeat 94..122 CDD:276809 10/27 (37%)
TPR_11 132..198 CDD:290150 24/65 (37%)
TPR repeat 132..162 CDD:276809 15/29 (52%)
TPR_1 133..166 CDD:278916 16/32 (50%)
TPR 167..198 CDD:197478 8/30 (27%)
TPR repeat 167..195 CDD:276809 8/27 (30%)
TOC64-IIINP_188424.2 Amidase 33..451 CDD:418511 5/18 (28%)
3a0801s09 463..>588 CDD:273380 41/128 (32%)
TPR repeat 474..502 CDD:276809 10/27 (37%)
TPR repeat 507..537 CDD:276809 15/29 (52%)
TPR repeat 542..569 CDD:276809 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.