DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and tomm70a

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_956296.1 Gene:tomm70a / 572969 ZFINID:ZDB-GENE-030131-8173 Length:578 Species:Danio rerio


Alignment Length:188 Identity:63/188 - (33%)
Similarity:89/188 - (47%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKQNQLALDDEAEQGAAGGDSIATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVEGNE 103
            |||.:...:.:..:|:      |:|.......|..||    ::|||      .::|...|.:||:
Zfish    45 EKQGKRNGERKTPEGS------ASPVQGQHGATNPEL----ENLSP------LDRAQSAKNKGNK 93

  Fly   104 LFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVR 168
            .||....:.|.|.||||:.:||.....:.:..|.|||||..:.......|.||::|:||.|.||:
Zfish    94 YFKAGKYDHAIKCYTEAIGLCPKEKKGDLSTFYQNRAAAYEQQMKWTEVIQDCSQAVELNPRYVK 158

  Fly   169 VLLRRAKLYEQEDKPDEALEDYKKV--TEIDPGQQEAREAQIRLPPIINER-NEKLKN 223
            .|.||||..|:.|...|.|||...|  .|:...||....|...|..:..|: .||.||
Zfish   159 ALFRRAKALEKLDNKKECLEDVTAVCILEVFQNQQSMLLADKVLKQLGKEKAKEKYKN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 26/70 (37%)
TPR repeat 94..122 CDD:276809 12/27 (44%)
TPR_11 132..198 CDD:290150 28/67 (42%)
TPR repeat 132..162 CDD:276809 10/29 (34%)
TPR_1 133..166 CDD:278916 13/32 (41%)
TPR 167..198 CDD:197478 14/32 (44%)
TPR repeat 167..195 CDD:276809 13/29 (45%)
tomm70aNP_956296.1 TPR_11 83..154 CDD:290150 26/70 (37%)
TPR_1 84..116 CDD:278916 13/31 (42%)
TPR repeat 84..112 CDD:276809 12/27 (44%)
TPR repeat 122..152 CDD:276809 10/29 (34%)
TPR 277..560 CDD:223533
TPR repeat 299..327 CDD:276809
TPR repeat 336..366 CDD:276809
TPR repeat 371..399 CDD:276809
TPR repeat 446..474 CDD:276809
TPR repeat 479..510 CDD:276809
TPR repeat 515..542 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594913at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.