DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and unc-45

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster


Alignment Length:161 Identity:57/161 - (35%)
Similarity:84/161 - (52%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TANKEK---ADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEAN 149
            |.|.|:   |...|.:|||.||....|.|.:.|.:|  |...:..||.||.|.|||||.:||...
  Fly     4 TINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKA--IKAGSKHKELAVFYKNRAAAYLKLGKY 66

  Fly   150 KAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQQEAREAQIRLPPII 214
            :.|::|||::::..|...:.|.|||:.||..:|.:||.:|...:.:.|||.:..:....||..::
  Fly    67 ENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVV 131

  Fly   215 NER-------NEKLKNEMMSSLKDLGNMILK 238
            .||       :.|:| :||....||...|.|
  Fly   132 EERSARNAKTSTKVK-QMMDLTFDLATPIDK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 28/73 (38%)
TPR repeat 94..122 CDD:276809 11/27 (41%)
TPR_11 132..198 CDD:290150 25/65 (38%)
TPR repeat 132..162 CDD:276809 14/29 (48%)
TPR_1 133..166 CDD:278916 15/32 (47%)
TPR 167..198 CDD:197478 10/30 (33%)
TPR repeat 167..195 CDD:276809 10/27 (37%)
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 28/70 (40%)
TPR repeat 16..41 CDD:276809 10/26 (38%)
TPR repeat 46..79 CDD:276809 16/32 (50%)
TPR_11 50..115 CDD:290150 25/64 (39%)
TPR 50..83 CDD:197478 15/32 (47%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.