| Sequence 1: | NP_001262636.1 | Gene: | CG14894 / 41993 | FlyBaseID: | FBgn0038428 | Length: | 263 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_477441.1 | Gene: | STUB1 / 34433 | FlyBaseID: | FBgn0027052 | Length: | 289 | Species: | Drosophila melanogaster |
| Alignment Length: | 221 | Identity: | 42/221 - (19%) |
|---|---|---|---|
| Similarity: | 82/221 - (37%) | Gaps: | 70/221 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 96 KLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKE--RAVLYGNRAAAKIKLEANKAAIDDCTK 158
Fly 159 AIEL--------------------WPEYVRVLLRRAKLYEQE----------------DKPDEAL 187
Fly 188 EDYKKVTEID---------PGQQEAREAQIRL-----PPIINERNEKLKNEMMSSLKDLGNMILK 238
Fly 239 -----------PFGLSTQNFQMQQDP 253 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14894 | NP_001262636.1 | TPR_11 | 93..164 | CDD:290150 | 20/89 (22%) |
| TPR repeat | 94..122 | CDD:276809 | 10/25 (40%) | ||
| TPR_11 | 132..198 | CDD:290150 | 16/110 (15%) | ||
| TPR repeat | 132..162 | CDD:276809 | 8/29 (28%) | ||
| TPR_1 | 133..166 | CDD:278916 | 8/52 (15%) | ||
| TPR | 167..198 | CDD:197478 | 7/55 (13%) | ||
| TPR repeat | 167..195 | CDD:276809 | 5/43 (12%) | ||
| STUB1 | NP_477441.1 | TPR_11 | 17..78 | CDD:290150 | 20/67 (30%) |
| TPR | 17..47 | CDD:197478 | 12/36 (33%) | ||
| TPR repeat | 17..42 | CDD:276809 | 11/31 (35%) | ||
| TPR repeat | 47..77 | CDD:276809 | 8/29 (28%) | ||
| TPR repeat | 82..110 | CDD:276809 | 3/27 (11%) | ||
| U-box | 213..285 | CDD:252675 | 4/17 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45462446 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||