DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and Stip1

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster


Alignment Length:190 Identity:66/190 - (34%)
Similarity:91/190 - (47%) Gaps:25/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LREREKDLSPEQLTA--NKEKADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYG 137
            |.|.|..:..|:..|  |.|||::.|.:||..||..|...|.|.||||:...|     :...||.
  Fly   289 LSEVEAKIKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNP-----DDPKLYS 348

  Fly   138 NRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQQE 202
            ||||...||.|....:.||...|:|..::::..:|:.|:.:...:..:|...|:|..|:||...|
  Fly   349 NRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAE 413

  Fly   203 AREAQIRLPPIINERN--EKLKN-----EMMSSLKDLG-NMILKPFGLSTQNFQMQQDPN 254
            |.|. .|...:..:||  |.|||     |:...|||.. .|||:         |||.|||
  Fly   414 AIEG-YRQCSMNFQRNPQEVLKNAMSDPEIQQILKDPAMRMILE---------QMQSDPN 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 28/70 (40%)
TPR repeat 94..122 CDD:276809 13/27 (48%)
TPR_11 132..198 CDD:290150 19/65 (29%)
TPR repeat 132..162 CDD:276809 12/29 (41%)
TPR_1 133..166 CDD:278916 13/32 (41%)
TPR 167..198 CDD:197478 6/30 (20%)
TPR repeat 167..195 CDD:276809 5/27 (19%)
Stip1NP_477354.1 TPR_11 6..69 CDD:290150
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 40..103 CDD:290150
TPR repeat 72..100 CDD:276809
TPR_11 175..237 CDD:290150
TPR repeat 175..203 CDD:276809
TPR_1 181..208 CDD:278916
TPR_12 205..278 CDD:290160
TPR repeat 208..238 CDD:276809
TPR repeat 250..278 CDD:276809
TPR_1 250..>276 CDD:278916
TPR_11 309..375 CDD:290150 28/70 (40%)
TPR repeat 310..338 CDD:276809 13/27 (48%)
TPR_1 <317..343 CDD:278916 12/30 (40%)
TPR repeat 343..373 CDD:276809 12/29 (41%)
TPR_1 378..411 CDD:278916 8/32 (25%)
TPR repeat 378..406 CDD:276809 5/27 (19%)
STI1 439..478 CDD:128966 13/34 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.