DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and HIP

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_570074.3 Gene:HIP / 318211 FlyBaseID:FBgn0260484 Length:377 Species:Drosophila melanogaster


Alignment Length:241 Identity:57/241 - (23%)
Similarity:95/241 - (39%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VDEIVEKQNQLALDDEAEQGAAGG-------------------------DSIATPTTVDSELTIE 73
            |.:.|||........:...|:|||                         .|::.|.: |.||.:|
  Fly    35 VKDFVEKFGGTVPPGQFNGGSAGGKCPFGGVAGAKANEPANAPEDSEDEKSLSDPES-DVELDME 98

  Fly    74 ELREREKDLSPEQLTAN---------KEKADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASS 129
            .:.|.:.|  |.|...|         .|:|.:|:.:....:.....:.|...||:|:::.|.   
  Fly    99 GVIEADSD--PAQPMGNYSKKATEEEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPG--- 158

  Fly   130 KERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYV----------RVL---------LRRAK 175
              .|:.:..|..|.:||:...|.|.||..|:||..:..          |:|         ||:|.
  Fly   159 --NALFHAKRGQAFLKLKKPNACIRDCDVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQAC 221

  Fly   176 LYEQEDKPDEALEDY----KKVTEIDPGQQEAREAQIRLPPIINER 217
            ..:.:::.||.|::.    ||: |....:||.|:|:.:    |.||
  Fly   222 KLDFDEETDEWLKEVTPNAKKI-EQHRLKQERRQAERK----IKER 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 19/70 (27%)
TPR repeat 94..122 CDD:276809 6/27 (22%)
TPR_11 132..198 CDD:290150 23/88 (26%)
TPR repeat 132..162 CDD:276809 10/29 (34%)
TPR_1 133..166 CDD:278916 12/32 (38%)
TPR 167..198 CDD:197478 11/53 (21%)
TPR repeat 167..195 CDD:276809 10/50 (20%)
HIPNP_570074.3 Hip_N 10..47 CDD:271228 4/11 (36%)
TPR_11 125..190 CDD:290150 18/69 (26%)
TPR_2 126..159 CDD:285020 7/37 (19%)
TPR repeat 126..154 CDD:276809 6/27 (22%)
TPR repeat 159..189 CDD:276809 10/29 (34%)
TPR repeat 194..222 CDD:276809 5/27 (19%)
STI1 299..336 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.