DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and Tomm70

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_997684.1 Gene:Tomm70 / 304017 RGDID:1303049 Length:610 Species:Rattus norvegicus


Alignment Length:180 Identity:62/180 - (34%)
Similarity:95/180 - (52%) Gaps:13/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AGGDSIATPTTVDSELTIEELRERE-----KDLSPEQL-TANKEKADKLKVEGNELFKNDDAEGA 113
            |||...|:....:||....|.|...     .|.|.:.| .::.::|...|.:||:.||....|.|
  Rat    71 AGGRGDASGLKRNSERKTPEGRASPALGSGPDGSGDSLEMSSLDRAQAAKNKGNKYFKAGKYEQA 135

  Fly   114 AKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYE 178
            .:.||||:.:||:..:.:.:..|.|||||..:|:..|....|||||:||.|:||:.|.||||.:|
  Rat   136 IQCYTEAISLCPTEKNADLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHE 200

  Fly   179 QEDKPDEALEDYKKVTEIDPGQQEAREAQI---RLPPIINERN--EKLKN 223
            :.|...|.|||...|..::..|.|  ::.:   ::..::.:.|  ||.||
  Rat   201 KLDNKKECLEDVTAVCILEGFQNE--QSMLLADKVLKLLGKENAKEKYKN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 29/70 (41%)
TPR repeat 94..122 CDD:276809 12/27 (44%)
TPR_11 132..198 CDD:290150 30/65 (46%)
TPR repeat 132..162 CDD:276809 13/29 (45%)
TPR_1 133..166 CDD:278916 16/32 (50%)
TPR 167..198 CDD:197478 13/30 (43%)
TPR repeat 167..195 CDD:276809 13/27 (48%)
Tomm70NP_997684.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..109 10/37 (27%)
3a0801s09 <116..603 CDD:273380 51/135 (38%)
TPR 1 116..149 14/32 (44%)
TPR repeat 116..144 CDD:276809 12/27 (44%)
TPR repeat 149..184 CDD:276809 13/34 (38%)
TPR 2 155..188 16/32 (50%)
TPR 3 296..329
TPR 4 331..364
TPR repeat 331..359 CDD:276809
TPR repeat 364..398 CDD:276809
TPR 5 369..402
TPR 6 403..436
TPR repeat 403..431 CDD:276809
TPR 7 444..477
TPR repeat 446..472 CDD:276809
TPR 8 478..511
TPR repeat 478..506 CDD:276809
TPR repeat 511..542 CDD:276809
TPR 9 513..546
TPR 10 547..580
TPR repeat 547..574 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594913at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.