DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and Tomm70a

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_613065.2 Gene:Tomm70a / 28185 MGIID:106295 Length:611 Species:Mus musculus


Alignment Length:181 Identity:62/181 - (34%)
Similarity:95/181 - (52%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AGGDSIATPTTVDSELTIEE------LREREKDLSPEQL-TANKEKADKLKVEGNELFKNDDAEG 112
            |||...|:....:||....|      |.....|.|.:.| .::.::|...|.:||:.||....|.
Mouse    71 AGGRGDASGLKRNSERKTPEGRASPALGSGHHDGSGDSLEMSSLDRAQAAKNKGNKYFKAGKYEQ 135

  Fly   113 AAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLY 177
            |.:.||||:.:||:..:.:.:..|.|||||..:|:..|....|||||:||.|:||:.|.||||.:
Mouse   136 AIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAH 200

  Fly   178 EQEDKPDEALEDYKKVTEIDPGQQEAREAQI---RLPPIINERN--EKLKN 223
            |:.|...|.|||...|..::..|.|  ::.:   ::..::.:.|  ||.||
Mouse   201 EKLDNKKECLEDVTAVCILEGFQNE--QSMLLADKVLKLLGKENAKEKYKN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 29/70 (41%)
TPR repeat 94..122 CDD:276809 12/27 (44%)
TPR_11 132..198 CDD:290150 30/65 (46%)
TPR repeat 132..162 CDD:276809 13/29 (45%)
TPR_1 133..166 CDD:278916 16/32 (50%)
TPR 167..198 CDD:197478 13/30 (43%)
TPR repeat 167..195 CDD:276809 13/27 (48%)
Tomm70aNP_613065.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..110 10/38 (26%)
PLN03088 <117..604 CDD:330826 51/135 (38%)
TPR 1 117..150 14/32 (44%)
TPR repeat 117..145 CDD:276809 12/27 (44%)
TPR repeat 155..185 CDD:276809 13/29 (45%)
TPR 2 156..189 16/32 (50%)
TPR 3 297..330
TPR 4 332..365
TPR repeat 332..360 CDD:276809
TPR repeat 365..399 CDD:276809
TPR 5 370..403
TPR 6 404..437
TPR repeat 404..432 CDD:276809
TPR 7 445..478
TPR repeat 447..473 CDD:276809
TPR 8 479..512
TPR repeat 479..507 CDD:276809
TPR repeat 512..543 CDD:276809
TPR 9 514..547
TPR 10 548..581
TPR repeat 548..575 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594913at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.