DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14894 and ttc-1

DIOPT Version :9

Sequence 1:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_492795.1 Gene:ttc-1 / 172965 WormBaseID:WBGene00016390 Length:207 Species:Caenorhabditis elegans


Alignment Length:194 Identity:74/194 - (38%)
Similarity:112/194 - (57%) Gaps:11/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IEELREREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAVLY 136
            |||:.|.|:|    |:|    |.|.||.|||..|.|.:.|.|.:.|.||:..||..|::.:::|.
 Worm     4 IEEIFEDEED----QIT----KVDSLKKEGNNFFANGEFEKANEKYQEAIASCPPTSTEVQSILL 60

  Fly   137 GNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLY-EQEDKPDEALEDYKKVTEIDPGQ 200
            .|.|||.|||...::|::..:|:||:.....:.|.|||..| ...:|.:.::||||::.|..|.:
 Worm    61 SNSAAALIKLRKWESAVEAASKSIEIGATNEKALERRAFAYSNMSEKYENSIEDYKQLQESLPKR 125

  Fly   201 QEAREAQI-RLPPIINERNEKLKNEMMSSLKDLGNMILKPFGLSTQNFQMQQDPNTGSYSINFK 263
            :...:.:| .:...||.|||.:|.::|..||..||..|.||||||.:|:|..:.| |.:|:..|
 Worm   126 RVELDRKIAEINEKINNRNEAMKADVMEKLKGFGNFCLSPFGLSTDSFEMVPNGN-GGFSVQMK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 29/70 (41%)
TPR repeat 94..122 CDD:276809 13/27 (48%)
TPR_11 132..198 CDD:290150 23/66 (35%)
TPR repeat 132..162 CDD:276809 11/29 (38%)
TPR_1 133..166 CDD:278916 12/32 (38%)
TPR 167..198 CDD:197478 11/31 (35%)
TPR repeat 167..195 CDD:276809 10/28 (36%)
ttc-1NP_492795.1 TPR repeat 18..46 CDD:276809 13/27 (48%)
3a0801s09 <20..>115 CDD:273380 34/94 (36%)
TPR repeat 56..86 CDD:276809 11/29 (38%)
TPR repeat 91..120 CDD:276809 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I3376
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53302
OrthoDB 1 1.010 - - D1418232at2759
OrthoFinder 1 1.000 - - FOG0006488
OrthoInspector 1 1.000 - - oto18638
orthoMCL 1 0.900 - - OOG6_103243
Panther 1 1.100 - - LDO PTHR46014
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3538
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.