DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS33 and MRPS33

DIOPT Version :9

Sequence 1:NP_524380.1 Gene:mRpS33 / 41991 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_057155.1 Gene:MRPS33 / 51650 HGNCID:16634 Length:106 Species:Homo sapiens


Alignment Length:101 Identity:61/101 - (60%)
Similarity:76/101 - (75%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            ::||.||:.||.|:||||.|.||.||||||::|||.|:.|:....:|||.|.....||:.||..|
Human     5 SEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLG 69

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |:|||||||.:|.|||:|||||..|||||||||:|:
Human    70 LYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 52/88 (59%)
MRPS33NP_057155.1 MRP-S33 6..91 CDD:400544 49/84 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..106 18/24 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158483
Domainoid 1 1.000 110 1.000 Domainoid score I6317
eggNOG 1 0.900 - - E1_KOG4104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7729
Inparanoid 1 1.050 126 1.000 Inparanoid score I4704
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48500
OrthoDB 1 1.010 - - D1612570at2759
OrthoFinder 1 1.000 - - FOG0002259
OrthoInspector 1 1.000 - - oto89908
orthoMCL 1 0.900 - - OOG6_108088
Panther 1 1.100 - - LDO PTHR13362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3779
SonicParanoid 1 1.000 - - X7374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.