DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS33 and mrps33

DIOPT Version :9

Sequence 1:NP_524380.1 Gene:mRpS33 / 41991 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001002306.1 Gene:mrps33 / 432383 ZFINID:ZDB-GENE-040715-6 Length:106 Species:Danio rerio


Alignment Length:101 Identity:60/101 - (59%)
Similarity:75/101 - (74%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            :.||.||..||.||||:|:|.|:.:|:|||.:|.|.|:.:|..|.:|||.|...:.:.:.||..|
Zfish     5 SNYALRMARLSARIFGDVSRQTDARSLKVVELFKEPPLAQRKEVYDWYPPHKIYYSMTQRLRYMG 69

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |||||||||||||:||||||||..|.|||||||:||
Zfish    70 LFRDEHQDFKEEMRRLRKLRGKGRPNKGEGKRATKK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 51/88 (58%)
mrps33NP_001002306.1 MRP-S33 7..96 CDD:285492 51/88 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594417
Domainoid 1 1.000 106 1.000 Domainoid score I6542
eggNOG 1 0.900 - - E1_KOG4104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7729
Inparanoid 1 1.050 123 1.000 Inparanoid score I4716
OMA 1 1.010 - - QHG48500
OrthoDB 1 1.010 - - D1612570at2759
OrthoFinder 1 1.000 - - FOG0002259
OrthoInspector 1 1.000 - - oto41111
orthoMCL 1 0.900 - - OOG6_108088
Panther 1 1.100 - - LDO PTHR13362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3779
SonicParanoid 1 1.000 - - X7374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.