DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS33 and Mrps33

DIOPT Version :9

Sequence 1:NP_524380.1 Gene:mRpS33 / 41991 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001041328.1 Gene:Mrps33 / 296995 RGDID:1309217 Length:105 Species:Rattus norvegicus


Alignment Length:101 Identity:62/101 - (61%)
Similarity:77/101 - (76%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            ::||.||:.||.||||||||.|:.||||||.:|||:|:.|:....:|||.|.....||..||..|
  Rat     4 SEYAVRMSRLSARIFGEVARPTDSKSMKVVNLFSEQPLAKKKETYDWYPNHNTYFALMGTLRFLG 68

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |:||||||||:|.:||:|||||..|:|||||||:||
  Rat    69 LYRDEHQDFKDEQRRLKKLRGKGKPRKGEGKRATKK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 53/88 (60%)
Mrps33NP_001041328.1 MRP-S33 5..95 CDD:400544 53/89 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352487
Domainoid 1 1.000 112 1.000 Domainoid score I6070
eggNOG 1 0.900 - - E1_KOG4104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7729
Inparanoid 1 1.050 129 1.000 Inparanoid score I4556
OMA 1 1.010 - - QHG48500
OrthoDB 1 1.010 - - D1612570at2759
OrthoFinder 1 1.000 - - FOG0002259
OrthoInspector 1 1.000 - - oto97024
orthoMCL 1 0.900 - - OOG6_108088
Panther 1 1.100 - - LDO PTHR13362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7374
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.