DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS33 and Mrps33

DIOPT Version :9

Sequence 1:NP_524380.1 Gene:mRpS33 / 41991 FlyBaseID:FBgn0038426 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_034400.1 Gene:Mrps33 / 14548 MGIID:1338046 Length:106 Species:Mus musculus


Alignment Length:101 Identity:63/101 - (62%)
Similarity:79/101 - (78%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TQYARRMNYLSNRIFGEVARTTNEKSMKVVRMFSEEPIHKRDYVINWYPRHVETHLLMKNLRDYG 77
            ::||.||:.||.||||||||:|:.||||||.:|||:|:.|:....:|||.|.....||.|||..|
Mouse     5 SEYALRMSRLSARIFGEVARSTDSKSMKVVSLFSEQPLAKKKETYDWYPNHNTYFALMGNLRFLG 69

  Fly    78 LFRDEHQDFKEEMKRLRKLRGKAPPKKGEGKRASKK 113
            |:||||||||:|.:||:|||||..|:|||||||:||
Mouse    70 LYRDEHQDFKDEQRRLKKLRGKGKPRKGEGKRATKK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS33NP_524380.1 MRP-S33 15..104 CDD:285492 54/88 (61%)
Mrps33NP_034400.1 MRP-S33 6..96 CDD:369798 54/89 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..106 18/25 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848880
Domainoid 1 1.000 115 1.000 Domainoid score I6045
eggNOG 1 0.900 - - E1_KOG4104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7729
Inparanoid 1 1.050 131 1.000 Inparanoid score I4603
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002259
OrthoInspector 1 1.000 - - oto93485
orthoMCL 1 0.900 - - OOG6_108088
Panther 1 1.100 - - LDO PTHR13362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3779
SonicParanoid 1 1.000 - - X7374
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.