DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and FOX2

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_012934.1 Gene:FOX2 / 853878 SGDID:S000001717 Length:900 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:38/180 - (21%)
Similarity:64/180 - (35%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 FVRTDHPEIVLHSLALFYQLLEFGERTERDLLLSPAVLRTVQEWRVKAHDERILSSKAVKQVQVV 175
            |.:|.||          |||.::     .||:.....|...::..||.   :.|.:|.|......
Yeast   285 FNKTQHP----------YQLSDY-----NDLITKAKKLPPNEQGSVKI---KSLCNKVVVVTGAG 331

  Fly   176 KRFSQSDLEQFAQFTGDHNYIHSLETP----TEERRVHGALLNAVVAGIMGTQLPGPGTVVLEQN 236
            ....:|....||:: |....::.::.|    .|..:::|.          ||.:|....||.|  
Yeast   332 GGLGKSHAIWFARY-GAKVVVNDIKDPFSVVEEINKLYGE----------GTAIPDSHDVVTE-- 383

  Fly   237 FKFLKPCRIET--------DTVV-TVRLLQSRKISTVEYDIRQNDEVVFA 277
                .|..|:|        |.:| ...:|:.:..      ::..||..||
Yeast   384 ----APLIIQTAISKFQRVDILVNNAGILRDKSF------LKMKDEEWFA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 23/120 (19%)
FOX2NP_012934.1 hydroxyacyl-CoA-like_DH_SDR_c-like 5..255 CDD:187611
NADB_Rossmann 336..566 CDD:419666 23/111 (21%)
PLN02864 613..886 CDD:178455
HDE_HSD 782..894 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.