DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and ECH2

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_177742.2 Gene:ECH2 / 843947 AraportID:AT1G76150 Length:309 Species:Arabidopsis thaliana


Alignment Length:268 Identity:52/268 - (19%)
Similarity:95/268 - (35%) Gaps:85/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NLANFAYDPINWSHLLEADA-LDVF-----VASLETQDQL--LKVHGIAALCN------------ 89
            :|..|.|||   |.||.... ::::     .|||..:..|  |:..|.||:..            
plant    82 DLPGFKYDP---SLLLHGQQYIEIYRPLPSKASLINKVSLAGLQDKGKAAILELETRSYEEGSGE 143

  Fly    90 -LCLDKTAAKFIREQLKLLTGLFVRTDHPEIVLHSLALFYQLLEFGER---TERDLLLSPAVLRT 150
             ||:::|.. |:|.     .|.|..:..|               |..:   :.:.|     .::.
plant   144 LLCMNRTTV-FLRG-----AGGFSNSSQP---------------FSYKNYPSNQGL-----AVKI 182

  Fly   151 VQEWRVKAHDERILSSKAVKQVQVVKRFSQSDLEQFAQFTGDHNYIHS---------LETPTEER 206
            .|...:...:||...|:|:                ..:.:||:|.:||         ...|.   
plant   183 PQRQPLTVCEERTQPSQAL----------------LYRLSGDYNPLHSDPEFAKLAGFPRPI--- 228

  Fly   207 RVHG-ALLNAVVAGIMGTQLPGPGTVVLEQNFKFLKPCRIETDTVVTVRLLQSRKISTVEYDIRQ 270
             :|| ..|...:..|:.....|..|.|...:.:||... ...:|::|...|:..:: ..:..:::
plant   229 -LHGLCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTV-FPGETLITEMWLEGLRV-IYQTKVKE 290

  Fly   271 NDEVVFAG 278
            .::.|.||
plant   291 RNKTVLAG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 21/118 (18%)
ECH2NP_177742.2 PLN02864 1..309 CDD:178455 52/268 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.