DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and AT5G37290

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001318685.1 Gene:AT5G37290 / 833703 AraportID:AT5G37290 Length:180 Species:Arabidopsis thaliana


Alignment Length:160 Identity:45/160 - (28%)
Similarity:84/160 - (52%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSSHRTLKRRTPAQGIDRREYIGHLVDEYYTTTNIEAQQQVTANLANFAYDPINWSHLLEADAL 65
            ||::::..:.||...|..|.:|:..||.::...|:.|.::::.||||||||||.|::.|.:.:.|
plant     1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDEETKERIVANLANFAYDPYNYTILRQLNVL 65

  Fly    66 DVFVASLETQDQLLKVHGIAALCNLCLD-KTAAKFIREQ-----LKLLTGLFVRTDHPEIVLHSL 124
            ::||..:...::.|...||..:||.|.: |..|..:...     :|.|:.....|     |.::|
plant    66 ELFVDCITEPNEKLVEFGIGGICNACAEPKNVATIVEADGIPLIIKSLSSPVRNT-----VNYAL 125

  Fly   125 ALFYQLLEFGERTERDLLLSPAVLRTVQEW 154
            ...|.:.:: .|..|:.:|.|.|:..::.:
plant   126 GALYYMCDY-NRATREEILRPEVVDLIERY 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533
AT5G37290NP_001318685.1 armadillo repeat 23..49 CDD:293788 8/25 (32%)
armadillo repeat 56..92 CDD:293788 9/35 (26%)
Arm 94..133 CDD:395413 8/43 (19%)
armadillo repeat 97..128 CDD:293788 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3135
eggNOG 1 0.900 - - E1_KOG4646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566260at2759
OrthoFinder 1 1.000 - - FOG0007449
OrthoInspector 1 1.000 - - oto3424
orthoMCL 1 0.900 - - OOG6_106309
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5579
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.