DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and ARMC7

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_078861.1 Gene:ARMC7 / 79637 HGNCID:26168 Length:198 Species:Homo sapiens


Alignment Length:220 Identity:60/220 - (27%)
Similarity:92/220 - (41%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IDRREYIGHLVDEYYTTTNIEAQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQDQLLKV 81
            :.|..|:..||.|:..|.:.:|::||.||||||||||.|:.:|.:...||:|:.||..:::.|..
Human    11 VGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVE 75

  Fly    82 HGIAALCNLCLDKTAAKFIREQ--LKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERTERDLLLS 144
            ..|..|||||.|:...:.|...  :.|:... :.:.:.|.||.::.....|...|.....:|..:
Human    76 FAIGGLCNLCPDRANKEHILHAGGVPLIINC-LSSPNEETVLSAITTLMHLSPPGRSFLPELTAT 139

  Fly   145 PAVLRTVQEWRVKAHDERILSSKAVKQVQVVKRFSQS---DLEQFAQFTGDHNYIHSLETPTE-- 204
            |.                         ||.:.|||.|   .|...||.     ::....:|.:  
Human   140 PV-------------------------VQCMLRFSLSASARLRNLAQI-----FLEDFCSPRQVA 174

  Fly   205 ---ERRVHGALLNAVVAGIMGTQLP 226
               .|:.|.||         |..||
Human   175 EARSRQAHSAL---------GIPLP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 17/64 (27%)
ARMC7NP_078861.1 armadillo repeat 50..86 CDD:293788 12/35 (34%)
ARM 1 57..99 14/41 (34%)
Arm 87..126 CDD:278915 6/39 (15%)
armadillo repeat 91..122 CDD:293788 5/31 (16%)
ARM 2 100..140 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566260at2759
OrthoFinder 1 1.000 - - FOG0007449
OrthoInspector 1 1.000 - - oto91347
orthoMCL 1 0.900 - - OOG6_106309
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5247
SonicParanoid 1 1.000 - - X5579
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.