DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and armc7

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001070067.1 Gene:armc7 / 767659 ZFINID:ZDB-GENE-060929-288 Length:192 Species:Danio rerio


Alignment Length:137 Identity:43/137 - (31%)
Similarity:69/137 - (50%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DRREYIGHLVDEYYTTTNIEAQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQDQLLKVH 82
            ||.||:..||.|:..:.:.||::||.||||||||||.|...|......::|:..|..:::.....
Zfish    11 DRFEYLQGLVTEFQDSDSDEAKEQVLANLANFAYDPSNMEALRTLQVTELFLDMLTEENENFVEF 75

  Fly    83 GIAALCNLCLDKTAAKFIREQLKLLTGL-----FVRTDHPEIVLHSLALFYQLLEFGERTERDLL 142
            ||..||||.::..:    |:|:....|:     .:.:...|.||.::.....|:....|:|   :
Zfish    76 GIGGLCNLSMELES----RDQILQSGGVPLVISCLSSSRDETVLSAITTLMNLITASSRSE---I 133

  Fly   143 LSPAVLR 149
            ...|||:
Zfish   134 TDSAVLQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533
armc7NP_001070067.1 armadillo repeat 49..85 CDD:293788 9/35 (26%)
ARM 50..161 CDD:237987 21/98 (21%)
armadillo repeat 90..124 CDD:293788 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566260at2759
OrthoFinder 1 1.000 - - FOG0007449
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106309
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5247
SonicParanoid 1 1.000 - - X5579
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.