DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and Armc7

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001120994.1 Gene:Armc7 / 287827 RGDID:1310043 Length:198 Species:Rattus norvegicus


Alignment Length:220 Identity:63/220 - (28%)
Similarity:96/220 - (43%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IDRREYIGHLVDEYYTTTNIEAQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQDQLLKV 81
            :.|..|:..||.|:..|.:.:|::||.||||||||||.|:.:|.:...||:|:.||..:::.|..
  Rat    11 VGRLGYLQALVTEFQETESQDAKEQVLANLANFAYDPGNYQYLRQLQVLDLFLDSLSEENETLIK 75

  Fly    82 HGIAALCNLCLDKTAAKFIREQ--LKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERTERDLLLS 144
            ..|..|||||.||...:.|.:.  |.|:... :.:.:.|.||.::.....|...|.|:..:|...
  Rat    76 FAIGGLCNLCPDKANKEHILQAGGLPLIINC-LSSPNEETVLSAVTTLMYLNSPGTRSHSELTSL 139

  Fly   145 PAVLRTVQEWRVKAHDERILSSKAVKQVQVVKRFSQSD---LEQFAQFTGDHNYIHSLETPTE-- 204
            |.                         ||.:.|||.|.   |...||.     ::..|.:|::  
  Rat   140 PV-------------------------VQCMLRFSLSTNTRLRNLAQI-----FLEDLCSPSQVA 174

  Fly   205 ---ERRVHGALLNAVVAGIMGTQLP 226
               .::.|.||         |..||
  Rat   175 EARSQQAHSAL---------GIPLP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 17/64 (27%)
Armc7NP_001120994.1 armadillo repeat 17..43 CDD:293788 11/25 (44%)
armadillo repeat 50..86 CDD:293788 12/35 (34%)
Arm 87..122 CDD:395413 8/35 (23%)
armadillo repeat 91..125 CDD:293788 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566260at2759
OrthoFinder 1 1.000 - - FOG0007449
OrthoInspector 1 1.000 - - oto98429
orthoMCL 1 0.900 - - OOG6_106309
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5579
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.