DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and Armc7

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_808446.1 Gene:Armc7 / 276905 MGIID:2679719 Length:198 Species:Mus musculus


Alignment Length:215 Identity:60/215 - (27%)
Similarity:93/215 - (43%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IDRREYIGHLVDEYYTTTNIEAQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQDQLLKV 81
            :.|..|:..||.|:..|.:.:|::||.||||||||||.|:.:|.:...||:|:.||..:::.|..
Mouse    11 VGRLGYLQALVTEFQETESQDAKEQVLANLANFAYDPGNYQYLRQLQVLDLFLDSLSEENETLIK 75

  Fly    82 HGIAALCNLCLDKTAAKFIREQ--LKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERTERDLLLS 144
            ..|..|||||.||...:.:.:.  |.|:.|.....|. |.||.::.....|...|.|:..:|...
Mouse    76 FAIGGLCNLCADKANKEHVLQAGGLPLIIGCLSSPDE-ETVLSAVTTLMYLSSPGSRSHPELTSL 139

  Fly   145 PAVLRTVQEWRVKAHDERILSSKAVKQVQVVKRFS---QSDLEQFAQFTGDHNYIHSLETPTEER 206
            |.                         ||.:.|||   .:.|...||.     ::....:|::..
Mouse   140 PV-------------------------VQCMLRFSISASTRLRNLAQI-----FLEDFCSPSQVA 174

  Fly   207 RVHGALLNAVVAGIMGTQLP 226
            ..|....::.    :|..||
Mouse   175 EAHSQQAHSA----LGIPLP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 13/59 (22%)
Armc7NP_808446.1 ARM 11..122 CDD:237987 42/111 (38%)
armadillo repeat 17..43 CDD:293788 11/25 (44%)
armadillo repeat 50..86 CDD:293788 12/35 (34%)
ARM 1 57..99 14/41 (34%)
armadillo repeat 91..125 CDD:293788 7/34 (21%)
ARM 2 100..140 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007449
OrthoInspector 1 1.000 - - oto94927
orthoMCL 1 0.900 - - OOG6_106309
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5247
SonicParanoid 1 1.000 - - X5579
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.