DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and Htd2

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001335656.1 Gene:Htd2 / 109729085 MGIID:5827763 Length:158 Species:Mus musculus


Alignment Length:126 Identity:36/126 - (28%)
Similarity:66/126 - (52%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SKAVKQVQVVKRFSQSDLEQFAQFTGDHNYIHSLETPTEERR-----VHGALLNAVVAGIMGTQL 225
            :|...:.::.:.|:|.|:..|::.|||.|.:|..|...:..:     |||.|:|.:::.::||::
Mouse    26 TKVGDRAELSRAFTQQDVATFSELTGDANPLHLSEDFAKHSKFGKTIVHGVLINGLISALLGTKM 90

  Fly   226 PGPGTVVLEQNFKFLKPCRIETDTVVTV---RLLQSRKISTVEYDIRQNDEVVFAGSAKLL 283
            ||||.|.|.|..||..|..:....:.:.   ||.||..:..|...:.::.:.|..|..|::
Mouse    91 PGPGCVFLSQEIKFPAPLYVGEVVLASAEVKRLKQSVAVVAVSCCVIESKKTVMEGWVKVM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 35/119 (29%)
Htd2NP_001335656.1 R_hydratase 27..152 CDD:239533 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5247
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.