DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and AT5G60335

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001318847.1 Gene:AT5G60335 / 10723110 AraportID:AT5G60335 Length:166 Species:Arabidopsis thaliana


Alignment Length:140 Identity:37/140 - (26%)
Similarity:63/140 - (45%) Gaps:20/140 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSSKAVKQVQVVKR----FSQSDLEQFAQFTGDHNYIH-----SLETPTEERRVHGALLNAVVAG 219
            ::||.:.:|..|.|    ||..|::.:|:.:.|.|.:|     :.:...|.|.|||.|::::...
plant    20 VASKTLLKVGDVLRETRVFSSEDIKAYAEVSHDWNPLHFDPESARKAGFENRLVHGMLVSSMFPR 84

  Fly   220 IMGTQLPGPGTVVLEQNFKFLKPCRIETDTVVTVRLLQSR--------KISTVEYDIRQNDEVVF 276
            |:....  ||.|.:.|:..|..|..|..:.:..|:.:..|        |.||..:. ..|:.||.
plant    85 IISAHF--PGAVYVSQSLHFRSPVYIGDEILGLVQAIALRETKNKYIVKFSTKCFK-NHNELVVI 146

  Fly   277 AGSAKLLTRN 286
            .|.|..:..|
plant   147 DGEATAILPN 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 34/128 (27%)
AT5G60335NP_001318847.1 R_hydratase 26..154 CDD:239533 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43437
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.