DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14881 and armc7

DIOPT Version :9

Sequence 1:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_031749852.1 Gene:armc7 / 100216038 XenbaseID:XB-GENE-6048201 Length:197 Species:Xenopus tropicalis


Alignment Length:181 Identity:63/181 - (34%)
Similarity:92/181 - (50%) Gaps:24/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DRREYIGHLVDEYYTTTNI-------EAQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQ 75
            :|.:|:..||.|:..|.::       ||::||.||||||||||.|:|.|.:...||:|:..|...
 Frog     7 ERFQYLQTLVTEFQDTDSVVSPLNCSEAKEQVLANLANFAYDPRNFSDLRKLQVLDLFLDMLTEG 71

  Fly    76 DQLLKVHGIAALCNLCLDKTAAKFIREQ--LKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERTE 138
            ::.|...|:..|||||||||....|.:.  |||:... :.:...|.||.:|.....|.....|||
 Frog    72 NENLVEFGLGGLCNLCLDKTNKSHILDSGGLKLVINC-LSSRREETVLSALTTLMFLCTAASRTE 135

  Fly   139 RDLLLSPAVLRTVQEWRVKAHDERILSSKAV---------KQVQVVKRFSQ 180
               :.:|||:..:..:.:..:  |.:|:.|.         ||||..|..||
 Frog   136 ---VTAPAVVECMVRFSLSTN--RRISNLATIFLQDYCSDKQVQEAKELSQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 6/10 (60%)
armc7XP_031749852.1 armadillo repeat 52..88 CDD:293788 12/35 (34%)
armadillo repeat 93..124 CDD:293788 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8884
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5070
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566260at2759
OrthoFinder 1 1.000 - - FOG0007449
OrthoInspector 1 1.000 - - oto105124
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5579
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.