DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17565 and RGTB1

DIOPT Version :9

Sequence 1:NP_650540.1 Gene:CG17565 / 41989 FlyBaseID:FBgn0038424 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_568259.1 Gene:RGTB1 / 831094 AraportID:AT5G12210 Length:321 Species:Arabidopsis thaliana


Alignment Length:309 Identity:89/309 - (28%)
Similarity:147/309 - (47%) Gaps:21/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RLTQIFRLEHQYYLDAMLRRLPSNYE--CLDSSRAWCVYWILQAAQLLSFNFDDQTLNHVVQFLS 118
            ::.|:...:|..|: .|..:...::|  .:|..|....||.|....||. .....:...|:.:|.
plant     8 QMVQLVADKHVRYI-LMAEKKKESFESVVMDHLRMNGAYWGLTTLDLLD-KLGCVSEEEVISWLM 70

  Fly   119 NCRSPTGGFGGGPGQYAHLAPTYAAVNSLCIIGSEQAYRAIDRPTLVQFLFSVRDSDGSFRLHVD 183
            .|:..:|||.|..|...|:..|.:||..|.:.   .....:|...:..::..:::.||||...:.
plant    71 TCQHESGGFAGNTGHDPHILYTLSAVQILALF---DKINILDIGKVSSYVAKLQNEDGSFSGDMW 132

  Fly   184 GETDVRGAYCAISCAKLLNLPEPVIKELFAGTGDWIAQCQTYEGGFGGAPGLEAHGGYTFCGIAG 248
            ||.|.|.:|.||.|..:|...:.:..|...   .:|..|:..:||||..||.|:|.|..||.:..
plant   133 GEIDTRFSYIAICCLSILKCLDKINVEKAV---KYIVSCKNLDGGFGCTPGAESHAGQIFCCVGA 194

  Fly   249 LALLNEADKCDRQALLKWTLRRQMTYEGGFQGRTNKLVDGCYSFWVGATIPITQATLSGVDKQME 313
            ||:.......|:.:|..|...||:. .||..||..||.|.|||:||       .::|..:|:  .
plant   195 LAITGSLHHVDKDSLGWWLCERQLK-AGGLNGRPEKLADVCYSWWV-------LSSLIMIDR--V 249

  Fly   314 HTLFDVEALQEYILLCCQKQSGGLIDKPGKPQDLYHTCYTLSGVSIAQH 362
            |.: |...|.::||.|....:||:.|:|....|::||.:.::|:|:.::
plant   250 HWI-DKAKLVKFILDCQDLDNGGISDRPEDAVDIFHTYFGVAGLSLLEY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17565NP_650540.1 PLN02710 27..403 CDD:215380 89/309 (29%)
FTase 62..360 CDD:239223 88/299 (29%)
RGTB1NP_568259.1 PLN03201 5..320 CDD:215630 89/309 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1042804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.