DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17565 and Y48E1B.3

DIOPT Version :9

Sequence 1:NP_650540.1 Gene:CG17565 / 41989 FlyBaseID:FBgn0038424 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001254398.2 Gene:Y48E1B.3 / 174999 WormBaseID:WBGene00013002 Length:642 Species:Caenorhabditis elegans


Alignment Length:98 Identity:25/98 - (25%)
Similarity:42/98 - (42%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 QYAHLAPTYAAVNSLCIIGSEQAYRAID-----RPTL-VQFLFSVRDSDGSFRLHVD---GETDV 188
            |..|::......|:.|:: :::....||     ||.| ::..|    |.|:.|:.|.   |:...
 Worm   351 QIRHVSRLQGTANAYCVM-TDRTLHLIDDRFPGRPVLGLKHAF----SSGTHRMVVSNPVGDEAA 410

  Fly   189 RGAYCAISCAKLLNLPEPVIK--ELFA-GTGDW 218
            .|...:|.|...|.:....|.  :|:| .||.|
 Worm   411 GGNVYSIFCQDQLQVLNSSISMTKLYAHPTGVW 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17565NP_650540.1 PLN02710 27..403 CDD:215380 25/98 (26%)
FTase 62..360 CDD:239223 25/98 (26%)
Y48E1B.3NP_001254398.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1042804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.