DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17565 and fmnl2

DIOPT Version :9

Sequence 1:NP_650540.1 Gene:CG17565 / 41989 FlyBaseID:FBgn0038424 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_012826322.1 Gene:fmnl2 / 100491499 XenbaseID:XB-GENE-1004377 Length:1106 Species:Xenopus tropicalis


Alignment Length:96 Identity:22/96 - (22%)
Similarity:37/96 - (38%) Gaps:25/96 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 AIDRPTLVQFLFSVRDSDGSFRLHVDGETDVRGAYCAISCAKLLNLPEPVIKELFAGTGDWIAQC 222
            ||.|.:.::......:..||.::...|:.|:     :|:         |::......:|.     
 Frog   461 AIQRQSTLERKIHELEKQGSIKIQKKGDGDI-----SIT---------PMVASGSVPSGS----- 506

  Fly   223 QTYEGGFGGAPGLEAHGGYTFCG---IAGLA 250
               ||..|||||....|....||   :.|:|
 Frog   507 ---EGTPGGAPGASISGPSIPCGTTSVPGVA 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17565NP_650540.1 PLN02710 27..403 CDD:215380 22/96 (23%)
FTase 62..360 CDD:239223 22/96 (23%)
fmnl2XP_012826322.1 Drf_GBD 23..275 CDD:283920
Drf_FH3 278..475 CDD:283917 3/13 (23%)
FH2 630..981 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.