DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14880 and mtg

DIOPT Version :9

Sequence 1:NP_650538.1 Gene:CG14880 / 41986 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster


Alignment Length:185 Identity:52/185 - (28%)
Similarity:81/185 - (43%) Gaps:51/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TSFSCAGRP--AGYYADVETGCQVYHMC----DGLGRQFSYTCPNTTLFQQRMLICDHWYMVNCS 105
            ||||||.:.  .|.|||.:.||.|:|:|    ||:.|: |:.||..|||.|.:|.|:.|:.|:||
  Fly   397 TSFSCAKQKHFPGLYADTDLGCMVFHVCALTDDGMVRK-SFLCPENTLFDQTILKCNWWFYVDCS 460

  Fly   106 KAESNYAANLLI------------------GQRDKPFVNDEENSLRTPRPDLLDRPYAPDYSGES 152
            .:.|.|.:|:.|                  |||.:...:.:||:|     |:           :|
  Fly   461 SSTSVYDSNIPISKSYQLMKSLTYFSKYAGGQRHEQGGDKDENAL-----DI-----------DS 509

  Fly   153 FRSQYKQFTSNQNQIRDESVKGAGAGKSDPQISQTRWRIPPPSRTILPPAYEPQI 207
            .|...:.....|.|          |.|::.::.:.|.........::|...|.|:
  Fly   510 LRESMEGVARRQEQ----------AKKAELRVEEQRSMPKEDHEHVVPAEAEQQL 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 25/58 (43%)
COG3979 336..>457 CDD:226487
mtgNP_731221.2 CBM_14 409..459 CDD:279884 23/50 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.