DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14880 and CG14607

DIOPT Version :9

Sequence 1:NP_650538.1 Gene:CG14880 / 41986 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:199 Identity:64/199 - (32%)
Similarity:88/199 - (44%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NAIPKT----NPASLLIQKTSFSCAGRP-AGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQ 91
            :|||..    .|....:.:|:|.||.:| .|||||:|..|||:|:| .|.|.:|:.|||.|:|.|
  Fly   167 SAIPGVPGVDYPIYAQVPRTNFDCAQQPLPGYYADIEAQCQVFHIC-ALNRTYSFLCPNGTVFSQ 230

  Fly    92 RMLICDHWYMVNCSKAESNYAANLLIGQRDKPFVNDEENSLRTPRPDLLDRPYAPDYSGESFRSQ 156
            ..|:|..|...:|..|.|.||.|..|    ..:.....::|||...:.:.||.|.  |..:|.:.
  Fly   231 ETLVCVWWNQYDCVSAPSLYANNAYI----YDYSERSGSNLRTSNTNNVYRPAAS--SSAAFGAP 289

  Fly   157 YKQFTSNQNQIRDESVKGAGAGKSDPQISQTRWRIPPPSRTILPPAYEPQIELPSAQSAKPRIPI 221
            ... |..........|.|..:|:..           .||.|..|.| :||  .|....|..|..|
  Fly   290 LAT-TGTLRATGVSQVAGYNSGRGS-----------YPSATPTPTA-QPQ--SPYGAGAVLRPAI 339

  Fly   222 ITST 225
            :.||
  Fly   340 VPST 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 26/53 (49%)
COG3979 336..>457 CDD:226487
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.