DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14880 and CG13675

DIOPT Version :9

Sequence 1:NP_650538.1 Gene:CG14880 / 41986 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster


Alignment Length:302 Identity:76/302 - (25%)
Similarity:124/302 - (41%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AQNAIPKTNPASLLIQKTSFSCAGRPAGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQRML 94
            |.:|:||         ..:|:|.||..|||||.||.|||:|.|...|.|:|:.|||.|:|.|.:.
  Fly    60 AYDAVPK---------GLAFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVR 115

  Fly    95 ICDHWYMVNCSKAESNYAAN---LLIGQR-----DKPFVNDEENSLRTPRPDL----LDRPYAPD 147
            :||.|..|||..:|..|..|   ..|.:|     |..:..|:|..:.|.....    ..|.:...
  Fly   116 VCDWWSNVNCEGSEQLYQNNDELYRIPERQQQLNDVXYEADDEYKIGTANGTRQRGGRQRQFQKQ 180

  Fly   148 YSGESFRSQYKQFTSN--------QNQIRDESVKGAGAGKSDPQISQTRWRIPPPSRTILPPAYE 204
            ...:..:.|::...||        .|:|.|.|        :..::::..:|   .|.....|:..
  Fly   181 QQQKQQQQQHQALNSNTAIGGINSSNRIVDSS--------NYSKMTKNSFR---GSMRFTTPSTN 234

  Fly   205 PQIELPSA--------QSAKPRIPIITSTTTTTRATTTTRPTTTTRATTTTTTTRRPPVTARPKE 261
            ||....|:        |..|.......|:..:.|   .::|::.......:..|       |.:.
  Fly   235 PQSSYSSSQQQQQQQQQQQKQHQKQHNSSRNSER---KSKPSSVNHRDRDSNQT-------RSRN 289

  Fly   262 ALHNRRPNFQEHDMDDLGTSHSTRYNTSADFNSAESPLRETK 303
            ..||...:.::::.::..:....||||:...|.||  |::.|
  Fly   290 RTHNTPQSGKKNNSNNNSSRGKQRYNTNKFENDAE--LKDYK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 28/52 (54%)
COG3979 336..>457 CDD:226487
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.