DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment js and ckd

DIOPT Version :10

Sequence 1:NP_650538.1 Gene:js / 41986 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster


Alignment Length:132 Identity:45/132 - (34%)
Similarity:65/132 - (49%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WRLLTLA-LFCSALFLASEAQNAIPKTNPASLLIQ--KT-----------SFSCAGRPAGYYADV 62
            :|:|.|: :....:.||:   .|:....|||.:.|  ||           ||.|..|..|:|||:
  Fly    11 YRILWLSGVLLGPILLAA---IAVQGQEPASPVFQNHKTKEWTNLDNITFSFDCKRRSVGFYADM 72

  Fly    63 ETGCQVYHMCDGLGRQFSYTCPNTTLFQQRMLICDHWYMVNCSKAESNYAANLLIGQRDKPFVND 127
            |..||::||||..|.:..:.|.|.|.|.|...|||..|..||:::...:..|.|....|.|..:|
  Fly    73 EYNCQIFHMCDEEGNRIPHLCANETSFNQEYRICDWDYNFNCTESPKWFYLNELTYATDPPDEDD 137

  Fly   128 EE 129
            |:
  Fly   138 ED 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jsNP_650538.1 CBM_14 51..104 CDD:426342 23/52 (44%)
PHA03247 <192..481 CDD:223021
ckdNP_647796.2 CBM_14 61..111 CDD:426342 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.