DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and IDD5

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001324413.1 Gene:IDD5 / 814738 AraportID:AT2G02070 Length:602 Species:Arabidopsis thaliana


Alignment Length:330 Identity:69/330 - (20%)
Similarity:119/330 - (36%) Gaps:79/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 QSKPSTTSPTPASQPIPVSVPALSQAQPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILPS 687
            |...|...|..:|...|...|...||..|||.|..:|..|..|...::..:.:  |..|:.::  
plant    16 QDDQSHLLPPNSSAAAPPPPPPHHQAPLPPLEAPPQKKKRNQPRTPNSDAEVI--ALSPKTLM-- 76

  Fly   688 PQQEGQNATHSGSEAPTTSGLICPTCKREFKKKEHLTQHVKLHAGLRPFK--------------- 737
                            .|:..||..|.:.|:::::|..|.:.|.  .|:|               
plant    77 ----------------ATNRFICEVCNKGFQREQNLQLHRRGHN--LPWKLKQKSTKEVKRKVYL 123

  Fly   738 CSEEGC----------DKTFSRKEHLSRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIHTQTS 792
            |.|..|          |.|..:|.:..:|     |:|.:.|:.|.|.::    :....:.|::|.
plant   124 CPEPSCVHHDPSRALGDLTGIKKHYYRKH-----GEKKWKCDKCSKRYA----VQSDWKAHSKTC 179

  Fly   793 TETLYCCDVCNKNFATKLHYEKHREMHKKIRPESAAPGATASPAAAPAL-THVRSNGQVPNKA-- 854
            ....|.|| |...|:.:..:..||.....:..|||     ..|.:..:| :|....||..|.:  
plant   180 GTKEYRCD-CGTLFSRRDSFITHRAFCDALAQESA-----RHPTSLTSLPSHHFPYGQNTNNSNN 238

  Fly   855 -----VFEIKQERSAQQTQTQQPPAQVMHVVTTQDLAGNTITITQAPDSNMPGSLANYVQLGFSQ 914
                 :..:....:.|....|  |..|:.:.:.   .|.....:::....:..:.:.|    |.|
plant   239 NASSMILGLSHMGAPQNLDHQ--PGDVLRLGSG---GGGGGAASRSSSDLIAANASGY----FMQ 294

  Fly   915 FQNPS 919
            .||||
plant   295 EQNPS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 5/19 (26%)
zf-C2H2 736..760 CDD:278523 8/48 (17%)
C2H2 Zn finger 738..760 CDD:275368 7/31 (23%)
zf-H2C2_2 752..777 CDD:290200 6/24 (25%)
zf-C2H2 766..788 CDD:278523 3/21 (14%)
C2H2 Zn finger 768..788 CDD:275368 3/19 (16%)
zf-H2C2_2 780..808 CDD:290200 7/27 (26%)
C2H2 Zn finger 799..819 CDD:275368 6/19 (32%)
IDD5NP_001324413.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.