DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and ZNF79

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_009066.2 Gene:ZNF79 / 7633 HGNCID:13153 Length:498 Species:Homo sapiens


Alignment Length:348 Identity:93/348 - (26%)
Similarity:142/348 - (40%) Gaps:59/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 PQPQVKQQQTAGLSASGAPTATSANQAAMQRLSSNTTI----------TKVPKQPASLPAPAPTS 596
            |.|.:.|::..|.....|...|:..:.:  ...|:.|:          ...|:.......|..:.
Human    10 PGPALPQEENTGEEGMAAGLLTAGPRGS--TFFSSVTVAFAQERWRCLVSTPRDRFKEGIPGKSR 72

  Fly   597 N------PAKLPMLNKQNITISRISMQTAPKAQSKPSTTSPTPASQPIPVSVP--ALSQA--QPP 651
            :      |...|.:|      |::..:............||:|..:.|..|.|  |||:|  |.|
Human    73 SLVLLGLPVSQPGMN------SQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDP 131

  Fly   652 PLAAQHKKIVRKPPENQD--TSG-QKVKAARP---PQQILPSPQQEGQNATHSGSEAPTTSGLI- 709
                    .|..||.:.|  ||. :|....||   |||.:|...:..:..||  :|:...|.:: 
Human   132 --------CVEMPPGDSDHGTSDLEKSFNLRPVLSPQQRVPVEARPRKCETH--TESFKNSEILK 186

  Fly   710 --------CPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMY 766
                    |..|.:.|.....|:||.|.|.|.:|::|||  |.|.||:...|.:|...|:|:|.|
Human   187 PHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSE--CGKAFSQSSSLIQHQRIHTGEKPY 249

  Fly   767 TCEVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKLHYEKHREMHKKIRPESAAPGA 831
            .|..|.:.||:..||.||:|.||   .|..|.|..|.|.|:......:|:.:|...:|...:...
Human   250 KCSECGRAFSQNANLTKHQRTHT---GEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCG 311

  Fly   832 TASPAAAPALTHVRSN-GQVPNK 853
            .|...:|....|.|:: |:.|.|
Human   312 KAFRHSANLTNHQRTHTGEKPYK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 7/19 (37%)
zf-C2H2 736..760 CDD:278523 9/23 (39%)
C2H2 Zn finger 738..760 CDD:275368 9/21 (43%)
zf-H2C2_2 752..777 CDD:290200 9/24 (38%)
zf-C2H2 766..788 CDD:278523 10/21 (48%)
C2H2 Zn finger 768..788 CDD:275368 9/19 (47%)
zf-H2C2_2 780..808 CDD:290200 13/27 (48%)
C2H2 Zn finger 799..819 CDD:275368 5/19 (26%)
ZNF79NP_009066.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/12 (33%)
KRAB 40..98 CDD:214630 8/63 (13%)
KRAB_A-box 40..77 CDD:143639 4/36 (11%)
C2H2 Zn finger 172..189 CDD:275368 4/18 (22%)
C2H2 Zn finger 195..215 CDD:275368 7/19 (37%)
COG5048 <206..437 CDD:227381 47/134 (35%)
zf-H2C2_2 207..232 CDD:290200 13/26 (50%)
C2H2 Zn finger 223..243 CDD:275368 9/21 (43%)
zf-H2C2_2 235..260 CDD:290200 9/24 (38%)
C2H2 Zn finger 251..271 CDD:275368 9/19 (47%)
zf-H2C2_2 263..287 CDD:290200 12/26 (46%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
zf-H2C2_2 291..316 CDD:290200 4/24 (17%)
C2H2 Zn finger 307..327 CDD:275368 4/19 (21%)
zf-H2C2_2 319..344 CDD:290200 5/16 (31%)
C2H2 Zn finger 335..355 CDD:275368 93/348 (27%)
zf-H2C2_2 350..372 CDD:290200
C2H2 Zn finger 363..383 CDD:275368
zf-H2C2_2 375..400 CDD:290200
C2H2 Zn finger 391..411 CDD:275368
zf-H2C2_2 403..427 CDD:290200
C2H2 Zn finger 419..439 CDD:275368
zf-H2C2_2 431..456 CDD:290200
C2H2 Zn finger 447..467 CDD:275368
zf-H2C2_2 459..484 CDD:290200
C2H2 Zn finger 475..495 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.