| Sequence 1: | NP_650534.2 | Gene: | pad / 41981 | FlyBaseID: | FBgn0038418 | Length: | 924 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006722936.1 | Gene: | ZNF69 / 7620 | HGNCID: | 13138 | Length: | 569 | Species: | Homo sapiens |
| Alignment Length: | 197 | Identity: | 55/197 - (27%) |
|---|---|---|---|
| Similarity: | 85/197 - (43%) | Gaps: | 20/197 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 671 SGQK-VKAARPPQQILPSPQQEGQNATHSGSEAPTTSGLICPTCKREFKKKEHLTQHVKLHAGLR 734
Fly 735 PFKCSEEGCDKTFSRKEHL------SRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIHTQTST 793
Fly 794 ETLYCCDVCNKNFATKLHYEKHREMHKKIRPESAAPGATASPAAAPALTHVRSNGQVPNKAVFEI 858
Fly 859 KQ 860 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pad | NP_650534.2 | zf-AD | 16..87 | CDD:214871 | |
| C2H2 Zn finger | 710..730 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 736..760 | CDD:278523 | 7/29 (24%) | ||
| C2H2 Zn finger | 738..760 | CDD:275368 | 7/27 (26%) | ||
| zf-H2C2_2 | 752..777 | CDD:290200 | 10/30 (33%) | ||
| zf-C2H2 | 766..788 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 768..788 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 780..808 | CDD:290200 | 10/27 (37%) | ||
| C2H2 Zn finger | 799..819 | CDD:275368 | 4/19 (21%) | ||
| ZNF69 | XP_006722936.1 | KRAB | 27..>67 | CDD:214630 | |
| KRAB | 27..66 | CDD:279668 | |||
| C2H2 Zn finger | 169..189 | CDD:275368 | |||
| C2H2 Zn finger | 197..217 | CDD:275368 | |||
| COG5048 | 222..>540 | CDD:227381 | 46/163 (28%) | ||
| C2H2 Zn finger | 225..245 | CDD:275368 | |||
| zf-H2C2_2 | 241..262 | CDD:290200 | |||
| C2H2 Zn finger | 253..273 | CDD:275368 | |||
| zf-H2C2_2 | 266..290 | CDD:290200 | |||
| C2H2 Zn finger | 281..301 | CDD:275368 | |||
| zf-H2C2_2 | 295..318 | CDD:290200 | |||
| C2H2 Zn finger | 309..329 | CDD:275368 | |||
| C2H2 Zn finger | 337..357 | CDD:275368 | |||
| zf-H2C2_2 | 349..372 | CDD:290200 | |||
| C2H2 Zn finger | 365..385 | CDD:275368 | |||
| zf-H2C2_2 | 377..400 | CDD:290200 | 4/13 (31%) | ||
| C2H2 Zn finger | 393..413 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 405..430 | CDD:290200 | 7/29 (24%) | ||
| C2H2 Zn finger | 421..441 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 449..468 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 483..503 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 495..520 | CDD:290200 | 10/27 (37%) | ||
| C2H2 Zn finger | 511..531 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 523..546 | CDD:290200 | 3/22 (14%) | ||
| C2H2 Zn finger | 539..559 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||