DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and klf5l

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001035016.2 Gene:klf5l / 562670 ZFINID:ZDB-GENE-060312-34 Length:401 Species:Danio rerio


Alignment Length:560 Identity:118/560 - (21%)
Similarity:176/560 - (31%) Gaps:219/560 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 LNFVLSSPTAPQ---FTTSMPQFGGSQPQIQLQLMPGSGGVTSA-----------GTVP---AQT 331
            :..|:.:|...:   ||...|          :::..|.|...|:           .|.|   |||
Zfish     4 VGLVVGTPNTEERAVFTQLKP----------VRMCSGDGPEDSSVFEDVKPAVRIATNPVEMAQT 58

  Fly   332 QLNAAALLSSLAGPQSTTNLLSPNKCFLPITIRDENSDQQIVAHID-------------TKNLVL 383
            ::.....|     |||.. |||||       |.|:...::..:.:|             ..|::|
Zfish    59 RMEMDKYL-----PQSGP-LLSPN-------ITDKKYRRESASVVDEYFADEKPAPYSLNINVIL 110

  Fly   384 PTTYQVQMKL----QPQLATADGQPIMQLTPTSIPATLQLTPQTLGNPGSAFQGTTVTQNQFLAP 444
            |.|..::..|    :|.:.....:|.:. .|..|        |||....|.|.......:.|:.|
Zfish   111 PNTTHLRTGLYRPNKPTVHHIKTEPGLD-EPCGI--------QTLPEFTSVFSVPQTVNSLFIKP 166

  Fly   445 QQPLTQLPNTAQVTSQQIIRSPHTSTTNSQLVIRNVTNIPPTPTTPTSSKKAPTFKTPSPKQKPM 509
            :.|:|   :...:..||                                        ||..|.|:
Zfish   167 EIPVT---DELHIGPQQ----------------------------------------PSAYQMPV 188

  Fly   510 PSPKSKTTVGPSSGGSNGTSTNEFKRLITQTKPQPQVKQQQTAGLSASGAP--TATSANQAAMQR 572
            .|....|.....|...||.                             |||  |..:.|..|:..
Zfish   189 SSSDLTTMTFSHSQSMNGI-----------------------------GAPGRTMLNLNTVALTA 224

  Fly   573 LSSN----TTITKVPKQPASLPAPAPTSNPAKLPMLNKQNITISRISMQTAPKAQSKPSTTSPTP 633
            .|:.    .:.|....||.|||...|.|.|.                   :|:.|::..|     
Zfish   225 QSAEFVMPESFTYNSPQPHSLPPSPPNSQPG-------------------SPENQAELIT----- 265

  Fly   634 ASQPIPVSVPALSQAQPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILP------------ 686
                        |.|.|||..|:              .|.||....|...|:.            
Zfish   266 ------------SVAPPPPYQAR--------------LGMKVGQMTPHSMIMAHGQGILTGPRYN 304

  Fly   687 ---SPQQEGQNATHSGSEAPTTSGLICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFS 748
               :|:.|.:...|...:.          |.:.:.|..||..|.:.|.|.:|::||.||||..|:
Zfish   305 RRNNPELEKRRIHHCDFQG----------CNKVYTKSSHLKAHQRTHTGEKPYRCSWEGCDWRFA 359

  Fly   749 RKEHLSRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIH 788
            |.:.|:||...|:|.|.:.|..|.:.|||.|:|..|.:.|
Zfish   360 RSDELTRHYRKHTGAKPFKCIACSRCFSRSDHLALHMKRH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 5/19 (26%)
zf-C2H2 736..760 CDD:278523 11/23 (48%)
C2H2 Zn finger 738..760 CDD:275368 11/21 (52%)
zf-H2C2_2 752..777 CDD:290200 9/24 (38%)
zf-C2H2 766..788 CDD:278523 8/21 (38%)
C2H2 Zn finger 768..788 CDD:275368 8/19 (42%)
zf-H2C2_2 780..808 CDD:290200 3/9 (33%)
C2H2 Zn finger 799..819 CDD:275368
klf5lNP_001035016.2 COG5048 <226..>401 CDD:227381 58/234 (25%)
zf-C2H2 317..341 CDD:278523 6/33 (18%)
C2H2 Zn finger 324..341 CDD:275368 5/16 (31%)
zf-H2C2_2 333..>349 CDD:290200 6/15 (40%)
zf-C2H2 347..371 CDD:278523 11/23 (48%)
C2H2 Zn finger 349..371 CDD:275368 11/21 (52%)
zf-H2C2_2 363..388 CDD:290200 9/24 (38%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.