DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and CG5245

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster


Alignment Length:164 Identity:50/164 - (30%)
Similarity:76/164 - (46%) Gaps:26/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 VRKPPENQDTSGQKVKAARPPQQILPSPQQEGQNATHSGSEAPTTSGLICPTCKREFKKKEHLTQ 725
            |:..|....|...|:...||.::                    .|....|..|::.|.:||:|..
  Fly    55 VKGVPSKLKTCKSKIAKKRPLRK--------------------QTDTFKCTQCQKTFTRKENLES 99

  Fly   726 HVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIHTQ 790
            |::|||..|||:||.  |.|:|.|:.|..|||:.|. ::.:.|..|.|.|::..:|.:|...|| 
  Fly   100 HLRLHAEERPFECSH--CSKSFGRRTHYKRHLLKHE-KRPHKCSHCSKTFTQNSSLKQHLHEHT- 160

  Fly   791 TSTETLYCCDVCNKNFATKLHYEKHREMHKKIRP 824
              .|..:.|..|:.:||.|.|.:.|...|.:.||
  Fly   161 --GERPFKCTQCSTSFARKSHLQVHLRTHSEERP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 7/19 (37%)
zf-C2H2 736..760 CDD:278523 11/23 (48%)
C2H2 Zn finger 738..760 CDD:275368 10/21 (48%)
zf-H2C2_2 752..777 CDD:290200 9/24 (38%)
zf-C2H2 766..788 CDD:278523 6/21 (29%)
C2H2 Zn finger 768..788 CDD:275368 6/19 (32%)
zf-H2C2_2 780..808 CDD:290200 8/27 (30%)
C2H2 Zn finger 799..819 CDD:275368 7/19 (37%)
CG5245NP_650197.1 COG5048 74..478 CDD:227381 45/145 (31%)
C2H2 Zn finger 84..104 CDD:275368 7/19 (37%)
C2H2 Zn finger 112..132 CDD:275368 10/21 (48%)
C2H2 Zn finger 139..159 CDD:275368 6/19 (32%)
C2H2 Zn finger 167..187 CDD:275368 7/19 (37%)
zf-H2C2_2 179..204 CDD:290200 5/14 (36%)
C2H2 Zn finger 195..215 CDD:275368
C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 250..270 CDD:275368
C2H2 Zn finger 278..298 CDD:275368
C2H2 Zn finger 306..326 CDD:275368
C2H2 Zn finger 334..354 CDD:275368
C2H2 Zn finger 362..382 CDD:275368
C2H2 Zn finger 390..410 CDD:275368
C2H2 Zn finger 418..438 CDD:275368
C2H2 Zn finger 446..466 CDD:275368
C2H2 Zn finger 474..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.