DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and Meics

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_524062.1 Gene:Meics / 39539 FlyBaseID:FBgn0025874 Length:583 Species:Drosophila melanogaster


Alignment Length:146 Identity:50/146 - (34%)
Similarity:68/146 - (46%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 CPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCKKP 774
            ||.|.:.|.:|.::.:|.:.|:|::||||.|  |.:.||...||..||..|:|:|.|.|:.|.|.
  Fly   414 CPDCDKSFFEKSNMMKHQRTHSGIKPFKCEE--CGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKG 476

  Fly   775 FSRKDNLNKHRRIH------------------TQTS-------------TETLYCCDVCNKNFAT 808
            ||...:|.||...|                  ||.|             .:||:.|..|:..||.
  Fly   477 FSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFAL 541

  Fly   809 KLHYEKHREMHKKIRP 824
            |...:||...| ||||
  Fly   542 KKTLDKHITSH-KIRP 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 6/19 (32%)
zf-C2H2 736..760 CDD:278523 11/23 (48%)
C2H2 Zn finger 738..760 CDD:275368 9/21 (43%)
zf-H2C2_2 752..777 CDD:290200 12/24 (50%)
zf-C2H2 766..788 CDD:278523 9/21 (43%)
C2H2 Zn finger 768..788 CDD:275368 8/19 (42%)
zf-H2C2_2 780..808 CDD:290200 12/58 (21%)
C2H2 Zn finger 799..819 CDD:275368 7/19 (37%)
MeicsNP_524062.1 zf-AD 21..95 CDD:285071
C2H2 Zn finger 242..262 CDD:275368
C2H2 Zn finger 274..294 CDD:275368
zf-H2C2_2 287..311 CDD:290200
C2H2 Zn finger 302..322 CDD:275368
C2H2 Zn finger 330..350 CDD:275368
zf-H2C2_2 342..366 CDD:290200
C2H2 Zn finger 358..378 CDD:275368
C2H2 Zn finger 386..406 CDD:275368
COG5048 <395..583 CDD:227381 50/146 (34%)
zf-C2H2 412..434 CDD:278523 6/19 (32%)
C2H2 Zn finger 414..434 CDD:275368 6/19 (32%)
zf-H2C2_2 426..451 CDD:290200 10/26 (38%)
C2H2 Zn finger 442..462 CDD:275368 9/21 (43%)
zf-H2C2_2 454..478 CDD:290200 11/23 (48%)
C2H2 Zn finger 470..486 CDD:275368 6/15 (40%)
C2H2 Zn finger 500..520 CDD:275368 3/19 (16%)
C2H2 Zn finger 532..552 CDD:275370 7/19 (37%)
C2H2 Zn finger 559..579 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.