DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pad and CG1663

DIOPT Version :9

Sequence 1:	NP_650534.2	Gene:	pad / 41981	FlyBaseID:	FBgn0038418	Length:	924	Species:	Drosophila melanogaster
Sequence 2:	NP_610521.1	Gene:	CG1663 / 36012	FlyBaseID:	FBgn0033449	Length:	387	Species:	Drosophila melanogaster

Alignment Length:	113	Identity:	34/113 - (30%)
Similarity:	48/113 - (42%)	Gaps:	8/113 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   709 ICPTCKREFKKKEHLTQHVKLHAGLRP-FKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCK 772
            :|..|.:.|.....|.||...:...|| ::||.  ||.....|....:|...|:||:.|.||:|.
  Fly   229 VCHVCHQSFPLASKLEQHQARYHFKRPEWQCSR--CDYNAPSKWDFQQHQAMHAGQRNYICELCG 291

  Fly   773 KPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKLHYEKH-REMH 819
            ........|..|||.|.|..    .||..|::.|......:.| |::|
  Fly   292 HSSKTSSALAVHRRTHDQPK----LCCPHCSRQFRENSTLKSHIRKIH 335

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pad	NP_650534.2	zf-AD	16..87	CDD:214871
		C2H2 Zn finger	710..730	CDD:275368	6/19 (32%)
		zf-C2H2	736..760	CDD:278523	6/23 (26%)
		C2H2 Zn finger	738..760	CDD:275368	6/21 (29%)
		zf-H2C2_2	752..777	CDD:290200	8/24 (33%)
		zf-C2H2	766..788	CDD:278523	8/21 (38%)
		C2H2 Zn finger	768..788	CDD:275368	7/19 (37%)
		zf-H2C2_2	780..808	CDD:290200	10/27 (37%)
		C2H2 Zn finger	799..819	CDD:275368	5/20 (25%)
CG1663	NP_610521.1	MttA_Hcf106	<33..>91	CDD:294511
		C2H2 Zn finger	201..222	CDD:275368
		C2H2 Zn finger	259..279	CDD:275368	6/21 (29%)
		C2H2 Zn finger	287..307	CDD:275368	7/19 (37%)
		C2H2 Zn finger	314..335	CDD:275368	5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24377
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100