DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and CG32772

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster


Alignment Length:445 Identity:99/445 - (22%)
Similarity:153/445 - (34%) Gaps:162/445 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 TITKVPKQPASL-PAPA---PTSNPAKLPMLNKQNITIS-------RISMQTAPKAQSKPSTTSP 631
            ||.::..|.|:| ..|.   ||.......:.|..|...|       ..|...|..|.:..:.||.
  Fly     3 TICRLCFQTATLFQVPGYSIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSS 67

  Fly   632 TPASQPIPVSVPALSQAQPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILPSPQQEGQNAT 696
            :.||..   ...|::|.|      ||    :.|.:.|..:.|:       ||     ||:.|..:
  Fly    68 STASSS---DSDAIAQQQ------QH----QNPQQQQHQNSQQ-------QQ-----QQQQQMQS 107

  Fly   697 HSGSEAPTTS------GLI------CPTCKREFKKKEHLTQHV---------------------- 727
            .|.||...:.      .||      ||.|.:.|.:|..|..|:                      
  Fly   108 SSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAA 172

  Fly   728 ----------------------------------KLHAGLRPFKCSEEGCDKTFSRKEHLSRHLV 758
                                              :||.|.|||.|:|..|.::|::..:|:.|:.
  Fly   173 NLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMK 237

  Fly   759 SHSGQKMYTCEVCKKPFSRKDNLNKH-----------------------RRIHTQTSTETL---Y 797
            ||...:.|.|.||.|.|::..:||:|                       .::||...|..|   |
  Fly   238 SHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPY 302

  Fly   798 CCDVCNKNFATKLHYEKHREMHKKIR------PES--------------------AAPGATASPA 836
            .||.|::.|..:.|.::|.:||.:.:      |.|                    :.|  .|:.|
  Fly   303 ECDKCDEKFLQQAHLDQHLKMHDEFKFKCDICPSSFNQESLLKKHVQRHVEGRYLSCP--VANCA 365

  Fly   837 AAPALTHVRSNGQVPNKAVFEI---KQERSAQQTQT-QQPPAQVMHVVTTQDLAG 887
            .:.|:....|...:.|.|..|:   |:.:.|...|| |||.|.:...::.|...|
  Fly   366 ESFAVRQHLSKHLLTNHAHHELPPPKRSKKAGTLQTSQQPLAMIGQPLSLQHTTG 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 7/75 (9%)
zf-C2H2 736..760 CDD:278523 7/23 (30%)
C2H2 Zn finger 738..760 CDD:275368 6/21 (29%)
zf-H2C2_2 752..777 CDD:290200 10/24 (42%)
zf-C2H2 766..788 CDD:278523 9/44 (20%)
C2H2 Zn finger 768..788 CDD:275368 8/42 (19%)
zf-H2C2_2 780..808 CDD:290200 12/53 (23%)
C2H2 Zn finger 799..819 CDD:275368 6/19 (32%)
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 52/255 (20%)
C2H2 Zn finger 133..153 CDD:275368 7/19 (37%)
zf-H2C2_2 145..170 CDD:290200 2/24 (8%)
C2H2 Zn finger 161..181 CDD:275368 0/19 (0%)
zf-H2C2_2 173..198 CDD:290200 0/24 (0%)
C2H2 Zn finger 189..209 CDD:275368 0/19 (0%)
C2H2 Zn finger 217..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 10/24 (42%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
C2H2 Zn finger 275..296 CDD:275368 2/20 (10%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368 2/19 (11%)
C2H2 Zn finger 359..380 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.