DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and Klf6

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_035933.2 Gene:Klf6 / 23849 MGIID:1346318 Length:318 Species:Mus musculus


Alignment Length:221 Identity:54/221 - (24%)
Similarity:93/221 - (42%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 TSNPAKLPMLNKQ---NITISRISMQTAPKAQSKPSTTSPTP--ASQPIP---VSVPALSQAQPP 651
            :|:|.:..:::..   |:..:.::...:.::.......|||.  .|.||.   |:...||.:   
Mouse   117 SSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSDPIGEVLVNSGNLSSS--- 178

  Fly   652 PLAAQHKKIVRKPPENQDTSGQKVKAARPPQQI-------LPSPQQEGQNATHSGSEAPTTSGLI 709
                    ::..||.:.:.:       |...|:       ||||.:.....  ||......:|..
Mouse   179 --------VISTPPSSPEVN-------RESSQLWGCGPGDLPSPGKVRSGT--SGKSGDKGNGDA 226

  Fly   710 CPT------------CKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSG 762
            .|.            |::.:.|..||..|.:.|.|.:|::||.|||:..|:|.:.|:||...|:|
Mouse   227 SPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTG 291

  Fly   763 QKMYTCEVCKKPFSRKDNLNKHRRIH 788
            .|.:.|..|.:.|||.|:|..|.:.|
Mouse   292 AKPFKCSHCDRCFSRSDHLALHMKRH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 6/31 (19%)
zf-C2H2 736..760 CDD:278523 10/23 (43%)
C2H2 Zn finger 738..760 CDD:275368 10/21 (48%)
zf-H2C2_2 752..777 CDD:290200 9/24 (38%)
zf-C2H2 766..788 CDD:278523 8/21 (38%)
C2H2 Zn finger 768..788 CDD:275368 8/19 (42%)
zf-H2C2_2 780..808 CDD:290200 3/9 (33%)
C2H2 Zn finger 799..819 CDD:275368
Klf6NP_035933.2 COG5048 212..>300 CDD:227381 26/89 (29%)
zf-C2H2 235..259 CDD:278523 5/23 (22%)
C2H2 Zn finger 240..259 CDD:275368 5/18 (28%)
zf-H2C2_2 251..>267 CDD:290200 6/15 (40%)
C2H2 Zn finger 267..289 CDD:275368 10/21 (48%)
zf-H2C2_2 281..306 CDD:290200 9/24 (38%)
C2H2 Zn finger 297..317 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.