DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and EGR2

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_011537729.1 Gene:EGR2 / 1959 HGNCID:3239 Length:489 Species:Homo sapiens


Alignment Length:492 Identity:123/492 - (25%)
Similarity:183/492 - (37%) Gaps:129/492 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 QLATADGQPIMQLTPTSIPATLQLTPQTLGNPGSAFQGTTVT-QNQF-LAPQQPLTQ-----LPN 453
            |:....|..::.:..|....:|.|...:...|.||.:..|.| ..:| :.||.|...     :.|
Human    63 QMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIIN 127

  Fly   454 TAQVTSQQIIRSPHTSTTNSQLVIRNVTNIPPTP--TTP----TSSKKAPTF-KTPSPKQKPMPS 511
            .......|.:.||.::|.:|     :||:..|.|  |.|    |.|:..|.. ...||   |.|.
Human   128 IVSAGILQGVTSPASTTASS-----SVTSASPNPLATGPLGVCTMSQTQPDLDHLYSP---PPPP 184

  Fly   512 PKSKTTVGPSSGGSNGTSTNEFKRLITQTKPQPQVKQQQTAGLSASGAPTATSANQAAMQRLSSN 576
            |       |.||.:.                  .:.|..:|.|||  |.|:||::.|.       
Human   185 P-------PYSGCAG------------------DLYQDPSAFLSA--ATTSTSSSLAY------- 215

  Fly   577 TTITKVPKQPASLPAPAPTSNPAKLPMLNKQNITISRISMQTAPKAQSKPSTTSPTPASQPIPVS 641
                   ..|.|.|:|.|.::|...||:...        ....|....:....:..|..:|.|..
Human   216 -------PPPPSYPSPKPATDPGLFPMIPDY--------PGFFPSQCQRDLHGTAGPDRKPFPCP 265

  Fly   642 VPALSQAQPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILPSPQQEGQNATHSGSEAPTTS 706
            :..|  ..||||..  ...:|    |....|             ||....|..|: .|||.|...
Human   266 LDTL--RVPPPLTP--LSTIR----NFTLGG-------------PSAGVTGPGAS-GGSEGPRLP 308

  Fly   707 G-----------------------LICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFS 748
            |                       ::.|   |::..:...|   .:|.  ||:.|..||||:.||
Human   309 GSSSAAAAAAAAAAYNPHHLPLRPILRP---RKYPNRPSKT---PVHE--RPYPCPAEGCDRRFS 365

  Fly   749 RKEHLSRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKLHYE 813
            |.:.|:||:..|:|.|.:.|.:|.:.|||.|:|..|.|.||   .|..:.||.|.:.||.....:
Human   366 RSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT---GEKPFACDYCGRKFARSDERK 427

  Fly   814 KHREMH--KKIRPESAAPGATASPAAAPALTHVRSNG 848
            :|.::|  :|.|..||...:..:|:.|.....|:..|
Human   428 RHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGG 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 3/19 (16%)
zf-C2H2 736..760 CDD:278523 11/23 (48%)
C2H2 Zn finger 738..760 CDD:275368 11/21 (52%)
zf-H2C2_2 752..777 CDD:290200 9/24 (38%)
zf-C2H2 766..788 CDD:278523 9/21 (43%)
C2H2 Zn finger 768..788 CDD:275368 9/19 (47%)
zf-H2C2_2 780..808 CDD:290200 10/27 (37%)
C2H2 Zn finger 799..819 CDD:275368 6/19 (32%)
EGR2XP_011537729.1 DUF3446 107..179 CDD:403215 19/76 (25%)
zf-C2H2 353..377 CDD:395048 11/23 (48%)
C2H2 Zn finger 355..377 CDD:275368 11/21 (52%)
COG5048 381..>449 CDD:227381 24/70 (34%)
C2H2 Zn finger 385..405 CDD:275368 9/19 (47%)
C2H2 Zn finger 413..433 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.